Copy Link Print Information

IP-10/CXCL10 Protein, Human

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. IP-10/CXCL10 Protein, Human consists of 77 amino acids (V22-P98) and is expressed in E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • IP-10/CXCL10 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CXCL10 Protein, Human consists of 77 amino acids (V22-P98) and is expressed in E. coli.

Background

CXCL10 is a pro-inflammatory chemokine secreted by a wide spectrum of cells. CXCL10 activates T lymphocytes (Th1), NK cells, macrophages, dendritic and B cells. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, angiogenesis, immune dysfunction and tumor development[1].
Mature human CXCL10 shares 68% amino acid sequence identity with mouse and rat CXCL10.
Human CXCL10 gene, is initially isolated in 1985 by Luster while treating a lymphoma cell line (U937) with recombinant IFN-γ. CXCL10 cDNA has an open reading frame of 1173-bp containing 4 exons and encoding a protein of 98-amino acids. The primary translational product of the CXCL10 gene is a 12 kDa protein containing two internal disulfide cross bridges. CXCL10 exerts its biological effects by binding to CXCR3, a seven trans-membrane-spanning G protein-coupled receptor in a paracrine or autocrine fashion, which is predominantly expressed on activated T, B lymphocyte, natural killer (NK), dendritic and macrophage cells. CXCL10 induction depends predominantly on the carboxyl-terminal region of CXCR3, which is essential for CXCR3 internalization, chemotaxis and calcium mobilization induced by the CXCL10 ligand. The powerful chemotactic action of CXCL10 on activated lymphocytes allows it to modulate both innate and adaptive immunity, inducing tissue damage and modulating tumor formation[1].
  CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. ELR-negative CXCL10 is an angiostatic chemokine, which inhibits angiogenesis. Abnormal levels of CXCL10 have been observed in body fluids of individuals infected with viruses, bacteria, fungi and parasites[1].

In Vitro

Recombinant human CXCL10 (5-10 μg/mL; 3 days) attenuates the proliferation of CAG, U266 and RPMI-8266 myeloma cells, and human umbilical vein endothelial cells, implying that CXCL10 exhibits anti-angiogenic capacity[2].
Recombinant human CXCL10 (500 ng//mL; for 2 h) induces up-regulation of CXCR3 expression in MDA-MB-231, MCF-7 and T47D cells[3].

Verified Bioactivity

1.The ED50 is <0.2 μg/mL as measured by HUVEC cells, corresponding to a specific activity of >5.0 × 103 units/mg.
2.Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 45.45 ng/mL, corresponding to a specific activity is 2.200×104 U/mg.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Human CXCR3. The ED50 for this effect is <0.18 μg/mL.
4.Immobilized Recombinant Human CXCL10 at 2 μg/mL(100 μL/well) can bind Human CXCL10 Antibody(Eldelumab,Research Grade). The ED50 for this effect is 1.0-10.0 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P02778 (V22-P98)

  • Gene ID
    3627  [NCBI]
  • Molecular Construction
    • N-term
    • CXCL10 (M22-P98)
      Accession # P02778
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL10; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 10; Prev. SCYB10; Small-Inducible Cytokine B10; Prev. INP10; C-X-C Motif Chemokine 10; IP-10; Protein 10 From Interferon (Gamma)-Induced Cell Line; GIP-10; Interferon-Inducible Cytokine IP-1

  • AA Sequence

    VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

  • Predicted Molecular Mass

    8.6 kDa

  • Molecular Weight

    Approximately 9-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Liu M, et al. CXCL10/IP-10 in infectious diseases pathogenesis and potential therapeutic implications. Cytokine Growth Factor Rev. 2011 Jun;22(3):121-30. [Content Brief]

[2]. Liu M, et al. CXCL10/IP-10 in infectious diseases pathogenesis and potential therapeutic implications. Cytokine Growth Factor Rev. 2011 Jun;22(3):121-30. [Content Brief]

[3]. U Barash, et al. Heparanase enhances myeloma progression via CXCL10 downregulation. Leukemia. 2014 Nov;28(11):2178-87. [Content Brief]

[4]. Lilach Goldberg-Bittman, et al. The expression of the chemokine receptor CXCR3 and its ligand, CXCL10, in human breast adenocarcinoma cell lines. Immunol Lett. 2004 Mar 29;92(1-2):171-8. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 45.45 ng/mL, corresponding to a specific activity is 2.200×104 U/mg.

  • 1/16

    IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442. [Abstract]

    Customer Validation
     In the KPC xenograft model, compared to the PBS control group (administered every 3 days), the tumor volume in the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) were significantly reduced.

  • 1/16

    IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442. [Abstract]

    Customer Validation
     In the KPC xenograft model, compared to the PBS control group (administered every 3 days), the tumor weight in the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) were significantly reduced.

  • 1/16

    IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442. [Abstract]

    Customer Validation
     In the KPC xenograft model, compared with the PBS control group (administered every 3 days), the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) showed a significant increase in CD8+ T cell infiltration in tumor tissue.

  • 1/16

    IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245. [Abstract]

    Customer Validation
     The significantly enhanced of migration in the SKOV3 cell line with the addition of CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 10 h).

  • 1/16

    IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245. [Abstract]

    Customer Validation
     The significantly enhanced invasion in the SKOV3 cell line with the addition of CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 12 h).

  • 1/16

    IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245. [Abstract]

    Customer Validation
     The apoptosis of SKOV3 cells treated with or without CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 24 h).

  • IP-10/CXCL10 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • Experimental Validation Results for IP-10/CXCL10 Protein, Human
  • IP-10/CXCL10 Protein, Human Product Image

  • IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442. [Abstract]

    In the KPC xenograft model, compared to the PBS control group (administered every 3 days), the tumor volume in the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) were significantly reduced.

  • IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442. [Abstract]

    In the KPC xenograft model, compared to the PBS control group (administered every 3 days), the tumor weight in the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) were significantly reduced.

  • IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442. [Abstract]

    In the KPC xenograft model, compared with the PBS control group (administered every 3 days), the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) showed a significant increase in CD8+ T cell infiltration in tumor tissue.

  • IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245. [Abstract]

    The significantly enhanced of migration in the SKOV3 cell line with the addition of CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 10 h).

  • IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245. [Abstract]

    The significantly enhanced invasion in the SKOV3 cell line with the addition of CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 12 h).

  • IP-10/CXCL10 Protein, Human purchased from MedChemExpress. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245. [Abstract]

    The apoptosis of SKOV3 cells treated with or without CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 24 h).