1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC chemokine subfamily
  5. IP-10/CXCL10 Protein, Human

IP-10/CXCL10 Protein, Human

Cat. No.: HY-P7226
Handling Instructions

IP-10/CXCL10 Protein, Human is a member of the CXC chemokine family with pro-inflammatory and anti-angiogenic properties.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

IP-10/CXCL10 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

IP-10/CXCL10 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P02778 (M22-P98)

Gene ID

3627

Synonyms
rHuIP-10/CXCL10; C-X-C motif chemokine 10; Gamma-IP10; Mob-1
AA Sequence

MVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP

Molecular Weight

Approximately 8.6 kDa

Biological Activity
The ED50 is <0.2 μg/mL as measured by HUVEC cells, corresponding to a specific activity of >5.0 × 103 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM Tris, pH 8.0.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CXCL10 binds CXCR3 receptor to induce chemotaxis, apoptosis, cell growth and angiostasis. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, immune dysfunction and tumor development. CXCL10 is also recognized as a biomarker that predicts severity of various diseases[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IP-10/CXCL10 Protein, Human
Cat. No.:
HY-P7226
Quantity:
MCE Japan Authorized Agent: