1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL9
  6. MIG/CXCL9 Protein, Human (HEK293, His)

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis. MIG/CXCL9 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 103 amino acids (T23-T125).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis[1][2]. MIG/CXCL9 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 103 amino acids (T23-T125).

Background

CXCL9 is a member of the CXC family and has an important role in the chemotaxis of immune cells. It is secreted by various cell types including immune cells (T lymphocytes, NK cells, dendritic cells, macrophages, eosinophils, etc.), and non-immune cells (hepatic stellate cells, preadipocytes, thyrocytes, endothelial cell, tumor cells, and fibroblasts, etc)[1].
The amino acid sequence of human CXCL9 protein has low homology between mouse and rat CXCL9 protein.
CXCL9 is one of the ligands of chemokine receptor CXCR3 that mediates the infiltration of lymphocytes to focal sites and suppresses tumor growth. CXCL9 attracts CXCR3-(CXCR3-A and CXCR3-B) T lymphocytes, is involved in the pathogenesis of a variety of physiologic diseases during their initiation and their maintenance. The transcriptional regulation of CXCL9 is a multistep process involving many transcription factors, of which STAT1 and NF-κB are two most well-characterized members. Both the gene mutation of STAT1 and the blocking of the JA/STAT1 pathway can reduce CXCL9 expression induced by IFN-γ. Moreover, CXCL9 expression can be suppressed by reducing the levels of components of the STAT1-IRF-1 transcriptional activation pathway by Porphyromonas gingivalis that leads to the immune function decline. Lipopolysaccharide (LPS) and D-galactosamine could induce the phosphorylation of STAT1 and enhance the transcription of CXCL9 leading to the enhancement of liver inflammation, and even liver apoptosis and injury[1][2][3].
CXCL9 could promote cancer metastasis via enhanced migration and invasion of tumor cells, and breaking of the endothelial cells monolayer. However, as a tumor suppressor, it mainly recruited tumor-infiltrating CD8+ T cells and NK cells, and inhibited tumor angiogenesis. In Addition, IL-12 and Th1-derived IFN-γ exerted antitumor effects through the inhibitory effects of endogenous CXCL9 on tumor vasculature in human Burkitt's lymphoma. In cutaneous T-cell lymphoma, expression of CXCL9 was found at early stage but low at advanced stage. CXCL9 is also associated with human hepatic fibrosis and anti-fibrosis in mice. Furthermore, CXCL9 is highly expressed in atherosclerotic plaques of coronary arteries and specifically recruits CXCR3-bearing Th1 cells that increase the risk of plaque progression and the occurrences of myocardial infarction[1][2][3][4].

In Vivo

Recombinant human CXCL9 (100 ng/mL; 5 days) up-regulates PD-L1 expression in bladder cancer T24 cells through its receptor CXCR3. And CXCL9 (72 hours) significantly enhances STAT3 and Akt activation in T24 cells[2].
Recombinant human CXCL9 (1, 10, and 100 ng/mL; 72 or 96 h) enhanced the growth and migration of normal human cardiac fibroblasts (NHCFs)[3].

Biological Activity

Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is ≤80.07 ng/mL, corresponding to a specific activity is ≥1.249×104 U/mg.

  • Measured by its ability to chemoattract THP-1 human peripheral blood T-lymphocytes. The ED50 for this effect is 76.70 ng/mL, corresponding to a specific activity is 1.304×104 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q07325 (T23-T125)

Gene ID
Molecular Construction
N-term
CXCL9 (T23-T125)
Accession # Q07325
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-X-C motif chemokine 9; HuMIG; MIG; CXCL9; CMK; SCYB9
AA Sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Predicted Molecular Mass
12.8 kDa
Molecular Weight

Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MIG/CXCL9 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MIG/CXCL9 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIG/CXCL9 Protein, Human (HEK293, His)
Cat. No.:
HY-P72675
Quantity:
MCE Japan Authorized Agent: