CCL4 Protein, Human
Based on 4 publication(s) in Google Scholar
CCL4 Protein, Human is a small cytokine of the CC chemokine subfamily that binds to the CCR5 chemokine receptor on the cell surface, promotes leukocyte aggregation under various inflammatory conditions, and contributes to immune protection against human immunodeficiency virus type 1. CCL4 Protein, Human is a recombinant human CCL4 (A24-N92) expressed by E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CCL4 Protein, Human is a small cytokine of the CC chemokine subfamily that binds to the CCR5 chemokine receptor on the cell surface, promotes leukocyte aggregation under various inflammatory conditions, and contributes to immune protection against human immunodeficiency virus type 1. CCL4 Protein, Human is a recombinant human CCL4 (A24-N92) expressed by E. coli[1].
Background
CCL4, also known as macrophage inflammatory protein (MIP-1β), belongs to the CC chemokine family and is a protein encoded in humans by the CCL4 gene, which belongs to the 17q11-q21 region of chromosome 17 and has a molecular weight of approximately 8-10 kDa. CCL4 can be produced by monocytes, B cells, T cells, NK cells, dendritic cells, neutrophils, fibroblasts, endothelial cells, and epithelial cells[1]. In parallel, CCL4 can also act as a major HIV suppressor produced by CD8+ T cells, inducing dose-dependent inhibition of different strains of HIV-1, HIV-2 and monkey immunodeficiency virus (SIV). Among them, the N-terminal processed form CCL4 (3-69), produced by proteolytic cleavage of peripheral blood lymphocytes after secretion, retains the ability to induce down-regulation of chemokine receptor CCR5 surface expression and inhibit CCR5-mediated HIV-1 entry into T cells[2].
Verified Bioactivity
1. The ED50 is <100 ng/mL as measured by CHO-K1/Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells).
2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 2.785 ng/mL, corresponding to a specific activity is 3.59×105 U/mg.
3. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Human CCR5. The ED50 for this effect is 1.0-10.0 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (4)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P13236 (A24-N92)
-
Molecular Construction
-
N-term
-
CCL4 (A24-N92)
Accession # P13236 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse Mip-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
-
AA Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
-
Predicted Molecular Mass
7.8 kDa
-
Molecular Weight
Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. S G Irving, et al. Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q. Nucleic Acids Res. 1990 Jun 11;18(11):3261-70. [Content Brief]
[2]. Patricia Menten, et al. Macrophage inflammatory protein-1. Cytokine Growth Factor Rev. 2002 Dec;13(6):455-81. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)