1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC chemokine subfamily
  5. I-TAC/CXCL11 Protein, Human

I-TAC/CXCL11 Protein, Human

Cat. No.: HY-P7229
Handling Instructions

I-TAC/CXCL11 Protein, Human is a small cytokine belonging to the CXC chemokine family which can be strongly induced by IFN-gamma, and its receptor CXCR3.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

I-TAC/CXCL11 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

I-TAC/CXCL11 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O14625 (F22-F94)

Gene ID

6373

Synonyms
rHuI-TAC/CXCL11; C-X-C motif chemokine 11; Beta-R1; H174; IP-9; SCYB11
AA Sequence

MFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Molecular Weight

Approximately 8.4 kDa

Biological Activity
The ED50 is <2.5 μg/mL as measured by CHO cells, corresponding to a specific activity of >400 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CXCL11 is produced by a variety of cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs). Simultaneous stimulation of fibroblasts or endothelial cells with IFN-γ and interleukin-1β or the TLR3 ligand double-stranded RNA resulted in a synergistic increase of CXCL11 production. CXCL11 attracts activated T-helper 1 (Th1) lymphocytes and natural killer (NK) cells. Like CXCL9 or monokine induced by IFN-γ (Mig) and CXCL10 or IFN-γ–inducible protein-10 (IP-10), CXCL11 signals through CXC chemokine receptor 3 (CXCR3)[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
I-TAC/CXCL11 Protein, Human
Cat. No.:
HY-P7229
Quantity:
MCE Japan Authorized Agent: