1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. MCP-1/CCL2 Protein, Mouse

MCP-1/CCL2 Protein, Mouse

Cat. No.: HY-P7764
Handling Instructions

MCP-1/CCL2 Protein, Mouse is achemokine family member that drives the chemotaxis of myeloid and lymphoid cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $165 In-stock
Estimated Time of Arrival: December 31
50 μg $496 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

MCP-1/CCL2 Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Accession

P10148 (Q24-R96)

Gene ID

20296

Synonyms
rMuCCL2; C-C motif chemokine 2; Monocyte chemoattractant protein 1; Monocyte chemotactic protein 1; MCP-1; Ccl2; Scya2
AA Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Molecular Weight

Approximately 12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Monocyte chemoattractant protein-1 [MCP-1; C-C motif chemokine ligand 2 (CCL2)] is a member of the chemokine family, a collection of small, secreted, chemotactic cytokines. CCL2 is expressed by a variety of cells, such as endothelial cells, smooth muscle cells, fibroblasts, epithelial cells, mesangial cells, astrocytes, T cells and tumor cells, as well as by myeloid cells. CCL2 expression is inducible, triggered upon exposure to inflammatory stimuli, such as interleukin-1, interleukin-4, interleukin-6 (IL-1, IL-4, and IL-6), TNFα, TGFβ, lipopolysaccharide (LPS), IFNγ, platelet-derived growth factor (PDGF), vascular endothelial growth factor (VEGF), macrophage colony-stimulating factor (M-CSF), and granulocyte-macrophage colony-stimulating factor (GM-CSF). CCL2 is found in the circulation, where it has been suggested as a diagnostic biomarker of breast cancer and prostate cancer[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-1/CCL2 Protein, Mouse
Cat. No.:
HY-P7764
Quantity:
MCE Japan Authorized Agent: