1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MCP-3 Protein/CCL7
  6. MCP-3/CCL7 Protein, Mouse

MCP-3/CCL7 Protein, Mouse

Cat. No.: HY-P7243
COA Handling Instructions

MCP-3/CCL7 Protein, Mouse is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Mouse is a recombinant mouse MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7(Q24-P97).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $75 In-stock
50 μg $210 In-stock
100 μg $360 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE MCP-3/CCL7 Protein, Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MCP-3/CCL7 Protein, Mouse is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Mouse is a recombinant mouse MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7(Q24-P97)[1].

Background

CCL7, also known as monocyte chemotactic protein 3 (MCP3), is a small cell factor. In the human genome, CCL7 is encoded by the CCL7 gene located on chromosome 17q11.2-q12. It consists of 99 amino acids, including a signal peptide of 23 amino acids, while a mature protein of approximately 76 amino acids is secreted upon signal peptide cleavage. CCL7 is expressed in a variety of cell types, such as stromal cells, keratin-forming cells, airway smooth muscle cells, parenchymal cells, fibroblasts and leukocytes, and tumor cells[1]. CCL7 is generally present as a monomer and can bind to a variety of receptors, including CCR1, CCR2, CCR3, CCR5 and CCR10 to mediate effects on immune cell types.CCL7 can act as a chemoattractant, attracting a variety of leukocytes, including monocytes and neutrophils. It mediates the immune response by recruiting leukocytes to infected tissues and is also involved in monocyte mobilization and recruitment of monocytes to sites of inflammation, as well as inducing neutrophil migration to sites of inflammation by increasing intracellular Ca2+ flux. CCL7 is involved in antibacterial, antiviral and antifungal immune responses, as well as being associated with various immune diseases such as ulcerative colitis, multiple sclerosis or non-atopic and atopic asthma. At the same time, CCL7 expression activates antitumor immune responses[2].

In Vitro

CCL7(100 ng/mL, 8 h) reduces the fertilization rate of oocytes and sperm to 31.1 % in cumulus-oocyte complex (COC) but does not affect the fertilization rate of oocytes without oocula[3].

In Vivo

CCL7(i.p., 50 μg/kg) does not significantly alter ovulation, but decreases fertilization rate and significantly stimulates sperm chemotaxis without affecting spermatozoa chemotaxis in wide female mice[3].

Biological Activity

1.Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 100-300 ng/ml.
2. Measured by its ability to chemoattract THP-1 human monocytes. The ED50 this effect is 153.9 ng/mL, corresponding to a specific activity is 6497.726 U/mg.

  • Measured by its ability to chemoattract THP-1 human monocytes. The ED50 for this effect is 153.9 ng/mL, corresponding to a specific activity is 6497.726 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q03366 (Q24-P97)

Gene ID

20306  [NCBI]

Molecular Construction
N-term
CCL7 (Q24-P97)
Accession # Q03366
C-term
Synonyms
rMuMCP-3/CCL7; C-C motif chemokine 7; MCP3; SCYA7
AA Sequence

QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Molecular Weight

8.5-12.9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 2× PBS, pH 7.4 or 40 mM PB, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MCP-3/CCL7 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-3/CCL7 Protein, Mouse
Cat. No.:
HY-P7243
Quantity:
MCE Japan Authorized Agent: