Copy Link Print Information

Animal-Free IL-15 Protein, Mouse (His)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

The IL-15 protein is a cytokine that crucially shapes inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation and activation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. Animal-Free IL-15 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Animal-Free IL-15 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The IL-15 protein is a cytokine that crucially shapes inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation and activation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. Animal-Free IL-15 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

The IL-15 protein is a cytokine that plays a crucial role in the development of both inflammatory and protective immune responses against microbial invaders and parasites. It achieves this by modulating immune cells from both the innate and adaptive immune systems. IL-15 stimulates the proliferation and activation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. In monocytes, IL-15 induces the production of chemokines IL8 and monocyte chemotactic protein 1/CCL2, which attract neutrophils and monocytes to sites of infection. Unlike most cytokines, IL-15 is expressed on the surface of IL-15-producing cells in association with its high affinity IL15RA, delivering signals to target cells expressing IL2RB and IL2RG receptor subunits. This binding triggers phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. Additionally, in mast cells, IL-15 rapidly phosphorylates STAT6, consequently controlling mast cell survival and the release of cytokines like IL4.

Verified Bioactivity

Measure by its abilit to induce CTLL-2 cells proliferation. The ED50 for this effect is < 10 ng/mL, corresponding to a specific activity is > 1x105 IU/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession

    P48346 (N49-S162)

  • Gene ID
    16168  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • IL-15 (N49-S162)
      Accession # P48346
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15

  • AA Sequence

    NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS

  • Predicted Molecular Mass

    14.2 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of Proleukin buffer, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.1 EU/μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Customer Validation
     Survival curve showing sepsis mice treated with/without recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.), and IL-15α−/− sepsis mice receiving the same treatment (30 ng, n = 20/group). The results showed that within a sepsis context, Animal-Free IL-15 protein, Mouse (His) administration significantly decreased mortality induced by sepsis in mice (p < 0.05); however, these protective effects were diminished in IL-15Rα−/− mice (p < 0.005).

  • 1/16

    Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Customer Validation
     Organ damage (kidney, liver, spleen, and lung) in sepsis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 24 h, along with IL-15α−/− sepsis mice receiving the same treatment (n = 5/group).

  • 1/16

    Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Customer Validation
     Microbial loads in liver, spleen, and lung in candidiasis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 1 day, along with IL-15α−/− candidiasis mice receiving the same treatment (n = 5/group). The results showed that Animal-Free IL-15 protein, Mouse (His) inhibited bacterial growth in the liver, spleen, lungs, and kidneys.

  • 1/16

    Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Customer Validation
     Confocal laser microscopy was used to observe macrophages (green fluorescence) phagocytosing fungi (red fluorescence) in candidiasis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 2 h, along with IL-15α−/− candidiasis mice receiving the same treatment (n = 5/group). The results showed that Animal-Free IL-15 protein, Mouse (His) significantly improved phagocytic activity (p < 0.005).

  • 1/16

    Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Customer Validation
     Serum IL-6, IL-12, IL-17, TNF-α, and IL-10 levels in candidiasis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 4 days, along with IL-15α−/− candidiasis mice receiving the same treatment (n = 5/group). Animal-Free IL-15 protein, Mouse (His) inhibited an increase in the anti-inflammatory cytokine IL-10; this phenomenon was possibly attributed to immunosuppression during advanced candidiasis stages in mice.

  • Animal-Free IL-15 Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Experimental Validation Results for Animal-Free IL-15 Protein, Mouse (His)
  • Animal-Free IL-15 Protein, Mouse (His) Product Image

  • Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Survival curve showing sepsis mice treated with/without recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.), and IL-15α−/− sepsis mice receiving the same treatment (30 ng, n = 20/group). The results showed that within a sepsis context, Animal-Free IL-15 protein, Mouse (His) administration significantly decreased mortality induced by sepsis in mice (p < 0.05); however, these protective effects were diminished in IL-15Rα−/− mice (p < 0.005).

  • Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Organ damage (kidney, liver, spleen, and lung) in sepsis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 24 h, along with IL-15α−/− sepsis mice receiving the same treatment (n = 5/group).

  • Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Microbial loads in liver, spleen, and lung in candidiasis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 1 day, along with IL-15α−/− candidiasis mice receiving the same treatment (n = 5/group). The results showed that Animal-Free IL-15 protein, Mouse (His) inhibited bacterial growth in the liver, spleen, lungs, and kidneys.

  • Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Confocal laser microscopy was used to observe macrophages (green fluorescence) phagocytosing fungi (red fluorescence) in candidiasis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 2 h, along with IL-15α−/− candidiasis mice receiving the same treatment (n = 5/group). The results showed that Animal-Free IL-15 protein, Mouse (His) significantly improved phagocytic activity (p < 0.005).

  • Animal-Free IL-15 Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cytokine. 2025 Sep 17:196:157026. [Abstract]

    Serum IL-6, IL-12, IL-17, TNF-α, and IL-10 levels in candidiasis mice treated with/without mouse recombinant IL-15 (Animal-Free IL-15 protein, Mouse (His)) (1.5 μg/kg; i.v.) after 4 days, along with IL-15α−/− candidiasis mice receiving the same treatment (n = 5/group). Animal-Free IL-15 protein, Mouse (His) inhibited an increase in the anti-inflammatory cytokine IL-10; this phenomenon was possibly attributed to immunosuppression during advanced candidiasis stages in mice.