Animal-Free IL-15 Protein, Mouse (His)

The IL-15 protein is a cytokine that crucially shapes inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation and activation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. Animal-Free IL-15 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

The IL-15 protein is a cytokine that plays a crucial role in the development of both inflammatory and protective immune responses against microbial invaders and parasites. It achieves this by modulating immune cells from both the innate and adaptive immune systems. IL-15 stimulates the proliferation and activation of natural killer cells, T-cells, and B-cells, while also promoting the secretion of various cytokines. In monocytes, IL-15 induces the production of chemokines IL8 and monocyte chemotactic protein 1/CCL2, which attract neutrophils and monocytes to sites of infection. Unlike most cytokines, IL-15 is expressed on the surface of IL-15-producing cells in association with its high affinity IL15RA, delivering signals to target cells expressing IL2RB and IL2RG receptor subunits. This binding triggers phosphorylation of JAK1 and JAK3, recruiting and subsequently phosphorylating signal transducer and activator of transcription-3/STAT3 and STAT5. Additionally, in mast cells, IL-15 rapidly phosphorylates STAT6, consequently controlling mast cell survival and the release of cytokines like IL4.

Measure by its abilit to induce CTLL-2 cells proliferation. The ED₅₀ for this effect is < 10 ng/mL, corresponding to a specific activity is > 1x10⁵ IU/mg.

Mouse

E. coli

N-6*His

P48346 (N49-S162)

16168  [NCBI]

Full Length of Mature Protein

NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 7.4 or Proleukin buffer, pH 7.5.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.