Copy Link Print Information

IL-15 Protein, Human

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IL-15 Protein, Human modulates immune cells of both the innate and adaptive immune systems, induces the production of chemokines and cytokines, stimulates the proliferation of natural killer cells, T-cells and B-cells. IL-15 Protein, Human triggers both pro-inflammatory and protective immune responses. IL-15 Protein, Human is the recombinant human-derived IL-15 Protein, expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • IL-15 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-15 Protein, Human modulates immune cells of both the innate and adaptive immune systems, induces the production of chemokines and cytokines, stimulates the proliferation of natural killer cells, T-cells and B-cells. IL-15 Protein, Human triggers both pro-inflammatory and protective immune responses. IL-15 Protein, Human is the recombinant human-derived IL-15 Protein, expressed by E. coli.

Background

Interleukin 15 is a cytokine that shares many biological properties with IL-2, including T, B and NK cell-stimulatory activities. Interleukin-15 has significant potential in cancer immunotherapy as an activator of antitumor CD8 T and natural killer (NK) cells[1]. Interleukin-15 (IL-15) is a pleiotropic cytokine and a member of the four α-helix bundle family of cytokines which include IL-2, IL-4, IL-7, IL-9, IL-15 and IL-21. IL-15 exhibits a broad biological activity and induces the differentiation and proliferation of T, B and natural killer (NK) cells. As a potent pro-inflammatory cytokine, IL-15 plays an important and complex role in autoimmune disease and inflammation. IL-15 plays a pivotal role in some hematological malignancies and presents anti-tumor effects. The direct administration of IL-15 has shown anti-tumor effects in several preclinical mouse tumor models[2].

In Vitro

IL-15 Protein (Human, 100 ng/mL, 8 days) increases myotube thickness, nuclear fusion index and myonuclei number in primary human myoblasts, promotes the expression of myogenesis-related genes myomaker, MYOD and MYOG[3].
IL-15 Protein (Human, 10-500 ng/mL, 12-24 h) induces the expression of chemokines (such as MIP-1α, MIP-1β and RANTES) and their receptors (such as CCR1, CCR4, CCR5, etc.) in peripheral blood T lymphocytes. IL-15 Protein promotes the entry and replication of mononuclear tropic HIV in T lymphocytes[4].

In Vivo

IL-15 Protein (10-50 µg/kg/day, iv, once daily for 12 days) exhibits immunostimulatory property, exhibits toxicity that leads to neutropenia in rhesus macaques. IL-15 Protein causes adverse reactions such as loss of appetite, diarrhea and vomiting with a high dose of 50 µg/kg/day[5].

Verified Bioactivity

1. The ED50 is <0.5 ng/mL as measured by CTLL-2 cells, corresponding to a specific activity of >2 × 106 units/mg.
2.The ED50 is ≤2 ng/mL, as measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P40933-1 (N49-S162)

  • Gene ID
    3600  [NCBI]
  • Molecular Construction
    • N-term
    • IL-15 (N49-S162)
      Accession # P40933-1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15

  • AA Sequence

    NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

  • Predicted Molecular Mass

    12.8 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Conlon KC, et al. Redistribution, hyperproliferation, activation of natural killer cells and CD8 T cells, and cytokine production during first-in-human clinical trial of recombinant human interleukin-15 in patients with cancer. J Clin Oncol. 2015 Jan 1;33(1):74-82. [Content Brief]

[2]. Sun W, et al. High level expression and purification of active recombinant human interleukin-15 in Pichiapastoris. J Immunol Methods. 2016 Jan;428:50-7. [Content Brief]

[3]. O'Leary MF, et al., IL-15 promotes human myogenesis and mitigates the detrimental effects of TNFα on myotube development. Sci Rep. 2017 Oct 11;7(1):12997. [Content Brief]

[4]. Perera L P, et al., IL-15 induces the expression of chemokines and their receptors in T lymphocytes[J]. The Journal of Immunology, 1999, 162(5): 2606-2612.

[5]. Waldmann TA, et al., Safety (toxicity), pharmacokinetics, immunogenicity, and impact on elements of the normal immune system of recombinant human IL-15 in rhesus macaques. Blood. 2011 May 5;117(18):4787-95. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • Experimental Validation Results for IL-15 Protein, Human
  • IL-15 Protein, Human Product Image