Animal-Free IL-7 Protein, Mouse (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. Animal-Free IL-7 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-7 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. Animal-Free IL-7 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-7 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-7, a hematopoietic cytokine, plays a pivotal role in the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are mediated through a receptor complex consisting of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, such as JAK1 or JAK3, depending on the cell type, leading to the propagation of signals through downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5. This interaction with its receptor components IL7R and CSF2RG is central to the diverse cellular responses elicited by IL-7.

Verified Bioactivity

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 106 IU/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Animal-Free IL-7 (E26-I154)
      Accession # P10168/Q544C8/NP_032397.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL7; IL7 Nirs Variant 5; Interleukin 7; IL7 Nirs Variant 3; IL-7; IMD130; Interleukin-7

  • AA Sequence

    ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

  • Predicted Molecular Mass

    15.8 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.1 EU/μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00