Animal-Free IL-7 Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. Animal-Free IL-7 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-7 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. Animal-Free IL-7 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-7 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
IL-7, a hematopoietic cytokine, plays a pivotal role in the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are mediated through a receptor complex consisting of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, such as JAK1 or JAK3, depending on the cell type, leading to the propagation of signals through downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5. This interaction with its receptor components IL7R and CSF2RG is central to the diverse cellular responses elicited by IL-7.
Verified Bioactivity
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 106 IU/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
iScience
AF6 regulates intestinal IgA via crosstalk between intestinal epithelial cells and immune cells in inflammatory bowel disease. [Abstract]2025 May 13;28(7):112658. PMID: 40687779
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P10168/Q544C8/NP_032397.1 (E26-I154)
-
Molecular Construction
-
N-term
-
Animal-Free IL-7 (E26-I154)
Accession # P10168/Q544C8/NP_032397.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL7; IL7 Nirs Variant 5; Interleukin 7; IL7 Nirs Variant 3; IL-7; IMD130; Interleukin-7
-
AA Sequence
ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
-
Predicted Molecular Mass
15.8 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<0.1 EU/μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)