1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-7
  5. IL-7 Protein, Mouse

IL-7 protein regulates lymphocyte population and maintains lymphoid homeostasis by developing, expanding, and supporting survival of T-cells and B-cells. It interacts with IL7R and CSF2RG receptors to exert its effects. IL-7 Protein, Mouse is the recombinant mouse-derived IL-7 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
Cell Proliferation/Viability Assay
WB
RT-PCR
Cell Migration/Invasion Assay

    IL-7 Protein, Mouse purchased from MCE. Usage Cited in: Cell Stem Cell. 2026 Apr 2;33(4):660-675.e5.  [Abstract]

    IL-7 Protein, Mouse (IL-7, 10-2000 nM; 48 h) promoted proliferation of both MSCs and tumor cells (4T1 cells) at concentrations <100 nM.

    IL-7 Protein, Mouse purchased from MCE. Usage Cited in: Mol Med. 2025 Apr 16;31(1):138.  [Abstract]

    The viability of RAW264.7 cells was detected by CCK-8 assay. The results showed that IL-7 Protein, Mouse (IL-7, 10 ng/mL; 24 h) treatment had no effect on cell viability in RAW264.7 macrophages transfected with shIL-7R or control shRNA.

    IL-7 Protein, Mouse purchased from MCE. Usage Cited in: Mol Med. 2025 Apr 16;31(1):138.  [Abstract]

    IL-7 Protein, Mouse (IL-7, 10 ng/mL; 24 h) stimulation upregulated IL-7R protein expression in RAW264.7 cells, whereas shIL-7R transfection reduced IL-7R levels.

    IL-7 Protein, Mouse purchased from MCE. Usage Cited in: Mol Med. 2025 Apr 16;31(1):138.  [Abstract]

    IL-7 Protein, Mouse (IL-7, 10 ng/mL; 24 h) stimulation upregulated IL-7R expression in RAW264.7 cells, whereas shIL-7R transfection reduced IL-7R levels.

    IL-7 Protein, Mouse purchased from MCE. Usage Cited in: Mol Med. 2025 Apr 16;31(1):138.  [Abstract]

    Transwell assay was performed to assess the migration of RAW264.7 cells in each group. The results displayed that the migratory ability of the shIL-7R group was weaker than that of the shRNA group after stimulation with IL-7 Protein, Mouse (IL-7, 10 ng/mL; 24 h). scale bar = 100 µm
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    Description

    IL-7 protein regulates lymphocyte population and maintains lymphoid homeostasis by developing, expanding, and supporting survival of T-cells and B-cells. It interacts with IL7R and CSF2RG receptors to exert its effects. IL-7 Protein, Mouse is the recombinant mouse-derived IL-7 protein, expressed by E. coli , with tag free.

    Background

    The IL-7 protein is a hematopoietic cytokine that plays a vital role in the development, expansion, and survival of naive and memory T-cells and B-cells, thus regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. It interacts with IL7R and CSF2RG receptors to exert its effects.

    Biological Activity

    1.Measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL) and the ED50 is typically 0.4-5.2 ng/mL.
    2.Measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood mononuclear cell (PBMC). The ED50 for this effect is typically 0.4-4 ng/mL.
    3.Measured by its binding ability in a functional ELISA. When Recombinant Mouse IL-7 is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human IL-7 R alpha. The ED50 for this effect is 1.814 ng/mL.

    • Measured by its binding ability in a functional ELISA. When Recombinant Mouse IL-7 is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human IL-7 R alpha. The ED50 for this effect is 1.814 ng/mL.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P10168/Q544C8/NP_032397.1 (E26-I154)

    Gene ID
    Molecular Construction
    N-term
    IL-7 (E26-I154)
    Accession # P10168/Q544C8/NP_032397.1
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Interleukin 7; Lymphopoietin-1; PBGF
    AA Sequence

    ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

    Predicted Molecular Mass
    15 kDa
    Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 90%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, 5% mannitol, 0.01% Tween 80.
    2.Lyophilized from a 0.22 μm filtered solution of PBS.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation

    IL-7 Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IL-7 Protein, Mouse

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-7 Protein, Mouse
    Cat. No.:
    HY-P73226
    Quantity:
    MCE Japan Authorized Agent: