BCA-1/CXCL13 Protein, Mouse (HEK293, Fc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches. BCA-1/CXCL13 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 88 amino acids (I22-A109).

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 88 amino acids (I22-A109).

Background

CXCL13, also known as B lymphocyte chemoattractant, is originally identified in stromal cells in B cell follicles as regulating homing of B cells and subsets of T cells. CXCL13 plays a key role in orchestrating cell migration within spatially distinct regions of the secondary lymphoid organs. It strongly attracts B lymphocytes while promoting migration of only small numbers of T cells and macrophages. CXCL13 and its receptor, CXCR5, play fundamental roles in inflammatory, infectious, cancer and immune responses[1][2][3].
The amino acid sequence of human CXCL13 protein has low homology with mouse CXCL13 protein.
CXCL13 exerts its functions through its receptor CXCR5. CXCR5 is highly expressed on mature recirculating B-lymphocytes, a subpopulation of follicular helper T cells (TFH) and skin-derived migratory dendritic cells (DCs), and controls their migration into secondary lymphoid organs towards the gradient of CXCL13. As the loss of the BLR1/CXCR5 receptor is sufficient to disrupt organization of follicles in spleen and Peyer's patches, BCA-1 may act as a B cell homing chemokine. Human BCA-1 competes with radiolabeled IFN-γ inducible protein 10 (IP-10) for binding to the human CXCR3 receptor expressed in Ba/F3 and 293EBNA cell lines. Furthermore, human BCA-1 is an efficacious attractant for human CXCR3 transfected cells. BCA-1 does oes not induce calcium release in B-lymphocytes. In addition, human BCA-1 is an agonist in stimulating GTP gamma S binding. Human BCA-1 is a specific and functional G-protein-linked chemotactic ligand for the human CXCR3 receptor. CXCL13 has been widely implicated in the pathogenesis of a number of autoimmune diseases and inflammatory conditions, as well as in lymphoproliferative disorders. In addition, the CXCL13:CXCR5 axis orchestrates cell-cell interactions that regulate lymphocyte infiltration within the tumor microenvironment[1][2][3].
Dysregulation of the CXCL13:CXCR5 axis affecting both B- and TFH cell function is major player in autoimmune disorders, and potentially serves as a biomarker for disease progression and therapeutic response. Moreover, expression of CXCR5 and CXCL13 is shown to be dysregulated in HIV infection, such that the number of CXCR5+ B cells decreases with progression of HIV infection, together with an increase in plasma levels of CXCL13. CXCL13/CXCR5 signaling modulates cancer cell ability to grow, proliferate, invade, and metastasize. CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5[1][2][3][4].

In Vitro

Recombinant mouse CXCL13 (15-20 ng/mL) induces alkaline phosphatase activity, deposition of calcium salts, and formation of calcium nodes, and it also increases the expression of Runx2 in rat bone mesenchymal stem cells (BMSCs)[6].

In Vivo

Recombinant mouse CXCL13 (100 ng; intrathecal injection) induces pain hypersensitivity and astrocyte activation via CXCR5 and ERK in wild type mice. Finally, intrathecal injection of CXCL13-activated astrocytes induced mechanical allodynia in naive mice[4].
Recombinant mouse CXCL13 (1 μg/mouse; i.p.; every other day 5 times.) induces tertiary lymphoid structures and enhances survival by the infiltration of CD8+ T cells in a mouse ovarian cancer model[5].

Verified Bioactivity

Measured by its ability to chemoattract Ramos cells. The ED50 for this effect is <1 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract Ramos cells. The ED50 for this effect is 0.5292 μg/mL, corresponding to a specific activity is 1.889×10^3 U/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • CXCL13 (I22-A109)
      Accession # O55038
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL13; C-X-C Motif Chemokine 13; Prev. SCYB13; CXC Chemokine BLC; BCA-1; BCA1; BLC; B-Cell-Homing Chemokine (Ligand For Burkitt'S Lymphoma Receptor-1); ANGIE2; Chemokine (C-X-C Motif) Ligand 13 (B-Cell Chemoattractant); BLR1L; Chemokine (C-X-C Motif) Lig

  • AA Sequence

    ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA

  • Predicted Molecular Mass

    35.8 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 500 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00