BCA-1/CXCL13 Protein, Mouse (HEK293, Fc)
Based on 1 publication(s) in Google Scholar
CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches. BCA-1/CXCL13 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 88 amino acids (I22-A109).
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 88 amino acids (I22-A109).
Background
CXCL13, also known as B lymphocyte chemoattractant, is originally identified in stromal cells in B cell follicles as regulating homing of B cells and subsets of T cells. CXCL13 plays a key role in orchestrating cell migration within spatially distinct regions of the secondary lymphoid organs. It strongly attracts B lymphocytes while promoting migration of only small numbers of T cells and macrophages. CXCL13 and its receptor, CXCR5, play fundamental roles in inflammatory, infectious, cancer and immune responses[1][2][3].
The amino acid sequence of human CXCL13 protein has low homology with mouse CXCL13 protein.
CXCL13 exerts its functions through its receptor CXCR5. CXCR5 is highly expressed on mature recirculating B-lymphocytes, a subpopulation of follicular helper T cells (TFH) and skin-derived migratory dendritic cells (DCs), and controls their migration into secondary lymphoid organs towards the gradient of CXCL13. As the loss of the BLR1/CXCR5 receptor is sufficient to disrupt organization of follicles in spleen and Peyer's patches, BCA-1 may act as a B cell homing chemokine. Human BCA-1 competes with radiolabeled IFN-γ inducible protein 10 (IP-10) for binding to the human CXCR3 receptor expressed in Ba/F3 and 293EBNA cell lines. Furthermore, human BCA-1 is an efficacious attractant for human CXCR3 transfected cells. BCA-1 does oes not induce calcium release in B-lymphocytes. In addition, human BCA-1 is an agonist in stimulating GTP gamma S binding. Human BCA-1 is a specific and functional G-protein-linked chemotactic ligand for the human CXCR3 receptor. CXCL13 has been widely implicated in the pathogenesis of a number of autoimmune diseases and inflammatory conditions, as well as in lymphoproliferative disorders. In addition, the CXCL13:CXCR5 axis orchestrates cell-cell interactions that regulate lymphocyte infiltration within the tumor microenvironment[1][2][3].
Dysregulation of the CXCL13:CXCR5 axis affecting both B- and TFH cell function is major player in autoimmune disorders, and potentially serves as a biomarker for disease progression and therapeutic response. Moreover, expression of CXCR5 and CXCL13 is shown to be dysregulated in HIV infection, such that the number of CXCR5+ B cells decreases with progression of HIV infection, together with an increase in plasma levels of CXCL13. CXCL13/CXCR5 signaling modulates cancer cell ability to grow, proliferate, invade, and metastasize. CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5[1][2][3][4].
In Vitro
Recombinant mouse CXCL13 (15-20 ng/mL) induces alkaline phosphatase activity, deposition of calcium salts, and formation of calcium nodes, and it also increases the expression of Runx2 in rat bone mesenchymal stem cells (BMSCs)[6].
In Vivo
Recombinant mouse CXCL13 (100 ng; intrathecal injection) induces pain hypersensitivity and astrocyte activation via CXCR5 and ERK in wild type mice. Finally, intrathecal injection of CXCL13-activated astrocytes induced mechanical allodynia in naive mice[4].
Recombinant mouse CXCL13 (1 μg/mouse; i.p.; every other day 5 times.) induces tertiary lymphoid structures and enhances survival by the infiltration of CD8+ T cells in a mouse ovarian cancer model[5].
Verified Bioactivity
Measured by its ability to chemoattract Ramos cells. The ED50 for this effect is <1 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Appl Toxicol
The Role of CXCL13 in GC-1 Cell Cycle Arrest Induced by Titanium Dioxide Nanoparticles Through JAK2/STAT3 Signaling Pathway. [Abstract]2025 May;45(5):830-840. PMID: 39777719
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
O55038 (I22-A109)
-
Molecular Construction
-
N-term
-
hFc
-
CXCL13 (I22-A109)
Accession # O55038 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL13; C-X-C Motif Chemokine 13; Prev. SCYB13; CXC Chemokine BLC; BCA-1; BCA1; BLC; B-Cell-Homing Chemokine (Ligand For Burkitt'S Lymphoma Receptor-1); ANGIE2; Chemokine (C-X-C Motif) Ligand 13 (B-Cell Chemoattractant); BLR1L; Chemokine (C-X-C Motif) Lig
-
AA Sequence
ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 500 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (264 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Jenh CH, et al. Human B cell-attracting chemokine 1 (BCA-1; CXCL13) is an agonist for the human CXCR3 receptor. Cytokine. 2001 Aug 7;15(3):113-21. [Content Brief]
[2]. Muzammal Hussain, et al. CXCL13/CXCR5 signaling axis in cancer. Life Sci. 2019 Jun 15;227:175-186. [Content Brief]
[3]. Marcelo G Kazanietz, et al. CXCL13 and Its Receptor CXCR5 in Cancer: Inflammation, Immune Response, and Beyond. Front Endocrinol (Lausanne). 2019 Jul 12;10:471. [Content Brief]
[4]. Bao-Chun Jiang, et al. CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5. J Clin Invest. 2016 Feb;126(2):745-61. [Content Brief]
[5]. Masayo Ukita, et al. CXCL13-producing CD4+ T cells accumulate in the early phase of tertiary lymphoid structures in ovarian cancer. JCI Insight. 2022 Jun 22;7(12):e157215. [Content Brief]
[6]. Feng Tian, et al. CXCL13 Promotes Osteogenic Differentiation of Mesenchymal Stem Cells by Inhibiting miR-23a Expression. Stem Cells Int. 2015;2015:632305. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)