Copy Link Print Information

KGF/FGF-7 Protein, Human

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

KGF/FGF-7 Protein is an epithelial cell-specific mitogen secreted by normal stromal fibroblasts. KGF/FGF-7 Protein activates plasminogen activator (PA) activity to promote extracellular matrix degradation. KGF/FGF-7 Protein, Human has activities such as promoting the proliferation and differentiation of epithelial cells (such as keratinocytes, thymic epithelial cells), repairing tissue damage (such as intestinal ischemia/reperfusion injury, bone defects), and regulating immune function (such as improving thymus function in aged mice). KGF/FGF-7 Protein, Human is a recombinant KGF/FGF-7 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • KGF/FGF-7 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KGF/FGF-7 Protein is an epithelial cell-specific mitogen secreted by normal stromal fibroblasts. KGF/FGF-7 Protein activates plasminogen activator (PA) activity to promote extracellular matrix degradation. KGF/FGF-7 Protein, Human has activities such as promoting the proliferation and differentiation of epithelial cells (such as keratinocytes, thymic epithelial cells), repairing tissue damage (such as intestinal ischemia/reperfusion injury, bone defects), and regulating immune function (such as improving thymus function in aged mice). KGF/FGF-7 Protein, Human is a recombinant KGF/FGF-7 protein expressed by E. coli without a tag.

Background

KGF/FGF-7 Protein belongs to the fibroblast growth factor family[1]. KGF/FGF-7 Protein is an epithelial cell-specific mitogen secreted by normal stromal fibroblasts[1]. KGF/FGF-7 Protein stimulates epithelial cell proliferation and migration and regulates differentiation processes by binding to specific receptors on the surface of epithelial cells. For example, under high calcium conditions, it promotes keratinocytes to express early (K1) and late (filagrin) differentiation markers, and activates plasminogen activator (PA) activity to promote extracellular matrix degradation[1][3]. KGF/FGF-7 Protein is expressed in mesenchymal cells of various tissues such as skin, gastrointestinal tract, lung, and thymus, and acts on epithelial cells through paracrine effects[1][2][5][6][7]. KGF/FGF-7 Protein, Human has activities such as promoting the proliferation and differentiation of epithelial cells (such as keratinocytes and thymic epithelial cells), repairing tissue damage (such as intestinal ischemia/reperfusion injury and bone defects), and regulating immune function (such as improving thymus function in aged mice). For example, it stimulates keratinocyte migration and PA activity in wound repair, and promotes the expression of osteogenic markers and new bone formation in bone defect models[1][3][4][5][6][7].

In Vitro

KGF/FGF-7 Protein, Human (10 ng/mL; 4 days) promotes human keratinocyte proliferation with an effect comparable to that of EGF[1].
KGF/FGF-7 Protein, Human (20 ng/mL; 6-48 h) induces increased SCF mRNA and protein secretion in human HaCaT keratinocytes[2].
KGF/FGF-7 Protein, Human (1 nM; 16 h) significantly stimulates human keratinocyte migration and urokinase-type plasminogen activator (uPA) activity[3].
KGF/FGF-7 Protein, Human (25-200 ng/mL; 48 h for migration test) stimulates migration of rat bone marrow stromal cells (BMSCs) and increases the expression of SDF-1 and CXCR4[4].

In Vivo

KGF/FGF-7 Protein, Human (5 mg/kg; s.c.; 3 days; before transplantation) reduces GVHD mortality and improves liver, lung and other organ damage in the B10.BR mouse allogeneic bone marrow transplantation model[5].
KGF/FGF-7 Protein, Human (5 mg/kg/d; i.p.; 5 days; before surgery) increases intestinal wet weight, reduces epithelial apoptosis, and restores tight junction protein distribution in the intestinal ischemia/reperfusion model of C57BL/6J mice[6].
KGF/FGF-7 Protein, Human (5 mg/kg/d; s.c.; 3 days) induces thymic regeneration, increases thymocyte number and naive T cell output in C57BL/6J mice[7].

Verified Bioactivity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells.The ED50 for this effect is ≤110.3 ng/mL, corresponding to a specific activity is ≥9.07×103 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cells.The ED50 for this effect is 15.20 ng/mL, corresponding to a specific activity is 6.6×104 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P21781-1 (C32-T194)

  • Gene ID
    2252  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-7 (C32-T194)
      Accession # P21781
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    FGF7; HBGF-7; Fibroblast Growth Factor 7; FGF-7; KGF; Fibroblast Growth Factor 7 (Keratinocyte Growth Factor); Keratinocyte Growth Factor; Fibroblast Growth Factor; Heparin-Binding Growth Factor 7; FGF

  • AA Sequence

    CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

  • Predicted Molecular Mass

    18.9 kDa

  • Molecular Weight

    Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 1 mM EDTA, 5% trehalose, 0.02% Tween 80, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0, 5% trehalose, 5% mannitol, 0.01% Tween 80.
5.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 8% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Marchese C, et al. Human keratinocyte growth factor activity on proliferation and differentiation of human keratinocytes: differentiation response distinguishes KGF from EGF family. J Cell Physiol. 1990 Aug;144(2):326-32. [Content Brief]

[2]. Belleudi F, et al. KGF Promotes Paracrine Activation of the SCF/c-KIT Axis from Human Keratinocytes to Melanoma Cells. Transl Oncol. 2010 Apr;3(2):80-90. [Content Brief]

[3]. Tsuboi R, et al. Keratinocyte growth factor (FGF-7) stimulates migration and plasminogen activator activity of normal human keratinocytes. J Invest Dermatol. 1993 Jul;101(1):49-53. [Content Brief]

[4]. Poudel SB, et al. Local delivery of recombinant human FGF7 enhances bone formation in rat mandible defects. J Bone Miner Metab. 2017 Sep;35(5):485-496. [Content Brief]

[5]. Panoskaltsis-Mortari A, et al. Keratinocyte growth factor administered before conditioning ameliorates graft-versus-host disease after allogeneic bone marrow transplantation in mice. Blood. 1998 Nov 15;92(10):3960-7. [Content Brief]

[6]. Cai Y, et al. Keratinocyte growth factor improves epithelial structure and function in a mouse model of intestinal ischemia/reperfusion. PLoS One. 2012;7(9):e44772. [Content Brief]

[7]. Min D, et al. Sustained thymopoiesis and improvement in functional immunity induced by exogenous KGF administration in murine models of aging. Blood. 2007 Mar 15;109(6):2529-37. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cells.The ED50 for this effect is 15.20 ng/mL, corresponding to a specific activity is 6.6×104 U/mg.

  • 1/16

    KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2025 Dec 8. [Abstract]

    Customer Validation
     Quantification of PCNA+ basal cells before irradiation and for 9 days post-irradiation. Vehicle, LIP-1 (5 mg/kg), KGF-1 (6.25 mg/kg), Spermidine (10 mg/kg), Spermine (10 mg/kg) (all administered via intraperitoneal injection), and 0.15% Benzydamine mouthwash (topical application), starting 7 days prior to irradiation and continuing until 9 days post-irradiation.

  • 1/16

    KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2025 Dec 8. [Abstract]

    Customer Validation
     H&E staining and epithelial thickness of mouse mucosa before irradiation and for 9 days post-irradiation. Vehicle, LIP-1 (5 mg/kg), KGF-1 (6.25 mg/kg), Spermidine (10 mg/kg), Spermine (10 mg/kg) (all administered via intraperitoneal injection), and 0.15% Benzydamine mouthwash (topical application), starting 7 days prior to irradiation and continuing until 9 days post-irradiation.

  • 1/16

    KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2025 May 5;16(1):227. [Abstract]

    Customer Validation
     The influence of varying FGF7 (20-50 ng/mL) concentrations on the osteogenic promotion of MG63, hFOB, and OPC cells under conditions of osteogenic induction.

  • 1/16

    KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2025 May 5;16(1):227. [Abstract]

    Customer Validation
     Effect of different concentrations of FGF7 (20-50 ng/mL) on bone marrow-derived osteoclastic progenitors under osteoclastogenesis induction.

  • KGF/FGF-7 Protein, Human Product Image
    1/16
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • Experimental Validation Results for KGF/FGF-7 Protein, Human
  • KGF/FGF-7 Protein, Human Product Image

  • KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2025 Dec 8. [Abstract]

    Quantification of PCNA+ basal cells before irradiation and for 9 days post-irradiation. Vehicle, LIP-1 (5 mg/kg), KGF-1 (6.25 mg/kg), Spermidine (10 mg/kg), Spermine (10 mg/kg) (all administered via intraperitoneal injection), and 0.15% Benzydamine mouthwash (topical application), starting 7 days prior to irradiation and continuing until 9 days post-irradiation.

  • KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Commun. 2025 Dec 8. [Abstract]

    H&E staining and epithelial thickness of mouse mucosa before irradiation and for 9 days post-irradiation. Vehicle, LIP-1 (5 mg/kg), KGF-1 (6.25 mg/kg), Spermidine (10 mg/kg), Spermine (10 mg/kg) (all administered via intraperitoneal injection), and 0.15% Benzydamine mouthwash (topical application), starting 7 days prior to irradiation and continuing until 9 days post-irradiation.

  • KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2025 May 5;16(1):227. [Abstract]

    The influence of varying FGF7 (20-50 ng/mL) concentrations on the osteogenic promotion of MG63, hFOB, and OPC cells under conditions of osteogenic induction.

  • KGF/FGF-7 Protein, Human purchased from MedChemExpress. Usage Cited in: Stem Cell Res Ther. 2025 May 5;16(1):227. [Abstract]

    Effect of different concentrations of FGF7 (20-50 ng/mL) on bone marrow-derived osteoclastic progenitors under osteoclastogenesis induction.