Copy Link Print Information

KGF/FGF-7 Protein, Human (N-His)

Customer Review

Based on 1 Customer Validation

KGF/FGF-7 Protein, Human (His) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Human (His) and its receptor are important for normal wound healing.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
  • KGF/FGF-7 Protein, Human (N-His) Product Image
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
  • KGF/FGF-7 Protein, Human (N-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KGF/FGF-7 Protein, Human (His) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Human (His) and its receptor are important for normal wound healing.

Background

Keratinocyte growth factor 1 or FGF-7 is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. FGF-7 and its receptor are believed to be important for normal wound healing[1].

Verified Bioactivity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 20.85 ng/mL, corresponding to a specific activity is 4.796×104 units/mg.

Results
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
    Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 20.85 ng/mL, corresponding to a specific activity is 4.796×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P21781-1 (C32-T194)

  • Gene ID
    2252  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • FGF-7 (C32-T194)
      Accession # P21781
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    rHuKeratinocyte Growth Factor/FGF-7, His; Keratinocyte Growth Factor; Fibroblast Growth Factor-7; HBGF-7

  • AA Sequence

    CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

  • Predicted Molecular Mass

    18.9 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7). J Biol Chem. 2002 Nov 8;277(45):42815-20. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL

KGF/FGF-7 Protein, Human (N-His) Related Classifications

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 20.85 ng/mL, corresponding to a specific activity is 4.796×104 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 20.85 ng/mL, corresponding to a specific activity is 4.796×104 units/mg.

  • KGF/FGF-7 Protein, Human (N-His) Product Image
    1/16
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
  • Experimental Validation Results for KGF/FGF-7 Protein, Human (N-His)
  • KGF/FGF-7 Protein, Human (N-His) Product Image