LOX-1/OLR1 Protein, Rat (HEK293, Fc)

The LOX-1/OLR1 protein plays an important role as a receptor that recognizes, internalizes, and degrades oxidatively modified low-density lipoprotein (oxLDL), a marker of atherosclerosis, in vascular endothelial cells. OxLDL induces endothelial dysfunction, triggering pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-hFc labeled tag.

LOX-1/OLR1 Protein functions as a receptor that plays a crucial role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL, a marker of atherosclerosis, induces endothelial cell activation and dysfunction, leading to pro-inflammatory responses, pro-oxidative conditions, and apoptosis. The association with oxLDL triggers the activation of NF-kappa-B, resulting in increased intracellular reactive oxygen species production and various pro-atherogenic cellular responses, including reduced nitric oxide release, monocyte adhesion, and apoptosis. Beyond its role in lipid metabolism, LOX-1/OLR1 acts as a receptor for HSP70, facilitating antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Moreover, it is involved in inflammatory processes, acting as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. Additionally, LOX-1/OLR1 serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. It forms homodimers, potentially organizing into hexamers composed of three homodimers, and interacts with HSP70.

Rat

HEK293

N-hFc

O70156 (L60-Q364)

140914  [NCBI]

Partial

LQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ

Approximately 66 kDa & 35 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/cho-cell.html  [Content Brief]