1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. MIP-5/CCL15 Protein, Human

MIP-5/CCL15 Protein, Human

Cat. No.: HY-P7266
Handling Instructions

MIP-5/CCL15 Protein, Human is a chemokine with a strong chemotactic activity for myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

MIP-5/CCL15 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

MIP-5/CCL15 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q16663 (Q22-I113)

Gene ID

6359

Synonyms
rHuMIP-5/CCL15; C-C motif chemokine 15; HCC-2; SCYA15; NCC3
AA Sequence

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Molecular Weight

Approximately 10.2 kDa

Biological Activity
The ED50 is <2 μg/mL as measured by CHO cells transfected with human CCR1, corresponding to a specific activity of >500 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CCL15 is a chemokine with a strong chemotactic activity for myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes[1]. Recombinant Human CCL15 is the most abundant chemokine in follicular thyroid carcinoma (FTC) compared with follicular adenoma (FA)[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-5/CCL15 Protein, Human
Cat. No.:
HY-P7266
Quantity:
MCE Japan Authorized Agent: