MIP-5/CCL15 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

MIP-5/CCL15 Protein, Human is a CC chemokine with strong chemotactic properties towards myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes. MIP-5/CCL15 Protein, Human binds to chemokine receptors CCR1 and CCR3 and plays a key role in leukocyte recruitment and inflammatory disease development. development. MIP-5/CCL15 Protein, Human is a recombinant human MIP-5/CCL15 (Q22-I113) expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

MIP-5/CCL15 Protein, Human is a CC chemokine with strong chemotactic properties towards myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes. MIP-5/CCL15 Protein, Human binds to chemokine receptors CCR1 and CCR3 and plays a key role in leukocyte recruitment and inflammatory disease development. development. MIP-5/CCL15 Protein, Human is a recombinant human MIP-5/CCL15 (Q22-I113) expressed by E. coli[1].

Background

CCL15, also known as macrophage inhibitory protein 5 (MIP-5), leukocyte chemokine 1 (Lkn-1) and human CC chemokine 2 (HCC-2), is a small cytokine belonging to the CC chemokine family, a cluster of chemokines located on human chromosome 17 with a gene sequence similar to CC motif chemokine ligand 5 (CCL5) and CC motif chemokine ligand 3 ( CCL3). CCL15 can be expressed in certain leukocytes and macrophages in the liver, small intestine, colon, and lung[1]. CCL15 acts as a chemoattractant for neutrophils, monocytes and lymphocytes and can bind to chemokine receptors CCR1 and CCR3, of which CCR3 is the major receptor for human eosinophils and plays an important role in the migration of monocytes, lymphocytes and neutrophils. Meanwhile, CCL15 plays an effector molecule role in the regulation of hematopoietic cells and host defense. Recombinant human CCL15 is also the most abundant chemokine in follicular thyroid cancer (FTC). CCL15 has been reported to be elevated in bronchoalveolar lavage fluid (BALF) from patients with stage III nodular disease and in peripheral blood from patients with severe persistent asthma, contributing to the severity and persistence of the disease by targeting its receptors (especially CCR1) in an autocrine manner[2][3].

In Vitro

CCL15 (0.1-1000 ng/mL) can mediate human eosinophilic leukemia EoL-1 cells migration and increase PKCσ activity in a time-dependent manner via the Ptx-sensitive Gi/Go protein and PLC. Besides, it enhances butyric acid-induced EoL-1 cell differentiation[2].
CCL15 is the most abundant chemokine in follicular thyroid carcinoma(FTC). 51.4-fold more CCL15 mRNA is present in FTC than in follicular adenoma. Condition medium of FTC cell lines induced THP-1 cell chemotaxis by 33 ~ 77%, and anti-CCL15 neutralizing antibodies reduces THP-1 cell migration in a dose-dependent manner[3].

Verified Bioactivity

1. The ED50 is <2 μg/mL as measured by CHO cells transfected with human CCR1, corresponding to a specific activity of >500 units/mg.
2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 6.04 ng/mL, corresponding to a specific activity is 1.56×105 U/mg.
3. Fuly biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human Tlymphocytes is in a concentration range of 1.0-10 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL15 (Q22-I113)
      Accession # Q16663
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL15; Chemokine (C-C Motif) Ligand 15; Prev. SCYA15; C-C Motif Chemokine 15; HCC-2; Leukotactin 1; NCC-3; NCC3; MIP-5; New CC Chemokine 3; Macrophage Inflammatory Protein 5; CC Chemokine 3; Chemokine CC-2; Leukotactin-1; MIP-1 Delta; MRP-2B; HMRP-2B; Mrp

  • AA Sequence

    QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

  • Predicted Molecular Mass

    10.2 kDa

  • Molecular Weight

    Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00