1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL15
  6. MIP-5/CCL15 Protein, Human

MIP-5/CCL15 Protein, Human is a CC chemokine with strong chemotactic properties towards myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes. MIP-5/CCL15 Protein, Human binds to chemokine receptors CCR1 and CCR3 and plays a key role in leukocyte recruitment and inflammatory disease development. development. MIP-5/CCL15 Protein, Human is a recombinant human MIP-5/CCL15 (Q22-I113) expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MIP-5/CCL15 Protein, Human is a CC chemokine with strong chemotactic properties towards myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes. MIP-5/CCL15 Protein, Human binds to chemokine receptors CCR1 and CCR3 and plays a key role in leukocyte recruitment and inflammatory disease development. development. MIP-5/CCL15 Protein, Human is a recombinant human MIP-5/CCL15 (Q22-I113) expressed by E. coli[1].

Background

CCL15, also known as macrophage inhibitory protein 5 (MIP-5), leukocyte chemokine 1 (Lkn-1) and human CC chemokine 2 (HCC-2), is a small cytokine belonging to the CC chemokine family, a cluster of chemokines located on human chromosome 17 with a gene sequence similar to CC motif chemokine ligand 5 (CCL5) and CC motif chemokine ligand 3 ( CCL3). CCL15 can be expressed in certain leukocytes and macrophages in the liver, small intestine, colon, and lung[1]. CCL15 acts as a chemoattractant for neutrophils, monocytes and lymphocytes and can bind to chemokine receptors CCR1 and CCR3, of which CCR3 is the major receptor for human eosinophils and plays an important role in the migration of monocytes, lymphocytes and neutrophils. Meanwhile, CCL15 plays an effector molecule role in the regulation of hematopoietic cells and host defense. Recombinant human CCL15 is also the most abundant chemokine in follicular thyroid cancer (FTC). CCL15 has been reported to be elevated in bronchoalveolar lavage fluid (BALF) from patients with stage III nodular disease and in peripheral blood from patients with severe persistent asthma, contributing to the severity and persistence of the disease by targeting its receptors (especially CCR1) in an autocrine manner[2][3].

In Vitro

CCL15 (0.1-1000 ng/mL) can mediate human eosinophilic leukemia EoL-1 cells migration and increase PKCσ activity in a time-dependent manner via the Ptx-sensitive Gi/Go protein and PLC. Besides, it enhances butyric acid-induced EoL-1 cell differentiation[2].
CCL15 is the most abundant chemokine in follicular thyroid carcinoma(FTC). 51.4-fold more CCL15 mRNA is present in FTC than in follicular adenoma. Condition medium of FTC cell lines induced THP-1 cell chemotaxis by 33 ~ 77%, and anti-CCL15 neutralizing antibodies reduces THP-1 cell migration in a dose-dependent manner[3].

Biological Activity

1. The ED50 is <2 μg/mL as measured by CHO cells transfected with human CCR1, corresponding to a specific activity of >500 units/mg.
2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 6.04 ng/mL, corresponding to a specific activity is 1.56×105 U/mg.
3. Fuly biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human Tlymphocytes is in a concentration range of 1.0-10 ng/mL.

  • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 6.04 ng/mL, corresponding to a specific activity is 1.56×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q16663 (Q22-I113)

Gene ID
Molecular Construction
N-term
CCL15 (Q22-I113)
Accession # Q16663
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuMIP-5/CCL15; C-C motif chemokine 15; HCC-2; SCYA15; NCC3
AA Sequence

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Molecular Weight

Approximately 10.2 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MIP-5/CCL15 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-5/CCL15 Protein, Human
Cat. No.:
HY-P7266
Quantity:
MCE Japan Authorized Agent: