1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Noggin Protein, Human (HEK293)

Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플 (5 μg)   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
250 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

    Noggin Protein, Human (HEK293) purchased from MCE. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072.

    Noggin (0-250 ng/mL; 24 h). CCK8 assay of the cytotoxicity of Noggin on yak PASMCs.

    Noggin Protein, Human (HEK293) purchased from MCE. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072.

    Western blot analysis of the expression levels of BMP signaling pathway-related proteins after treatment with various concentrations of Noggin (100 and 200 ng/mL).

    Noggin Protein, Human (HEK293) purchased from MCE. Usage Cited in: Animals (Basel). 2024 Jul 15;14(14):2072.

    TGF-β1 (5 ng/mL; 24 h) and Noggin (100 ng/mL; 24 h) promote the migration of Yak PASMCs.

    Noggin Protein, Human (HEK293) purchased from MCE. Usage Cited in: Stem Cell Res Ther. 2022 Aug 19;13(1):424.  [Abstract]

    Noggin (100 ng/mL; 3 days). Phospho-Smad1/5/9, BMP2, COL1A1 and RUNX2 were quantified in hBM-MSCs after 3 days of treatment with AU and/or Noggin by western blot analysis and normalized to GAPDH and tSmad1.
    • Biological Activity

    • Technical Parameters

    • Properties

    • 제품 설명

    • References

    제품 설명

    Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.

    Background

    Noggin Protein belongs to the bone morphogenetic protein (BMP) antagonist family of the TGF-β superfamily. Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin Protein binds to BMP to form a neutralizing complex, preventing BMP from binding to the receptor, thereby inhibiting BMP signaling and affecting cell survival, proliferation and differentiation[1]. Noggin Protein can be expressed in human arterial endothelial cells and bone marrow mesenchymal stem cells[1]. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency[1][2][3][4][5]. Noggin Protein, Human is composed of 232 amino acids, forming a covalently linked homodimer, and has the ability to bind to BMP4 with high affinity.

    In Vitro

    Noggin Protein, Human (200 ng/mL; 3-21 days) induces alkaline phosphatase activity and mineralization alone or synergistically with inflammatory cytokines/Dexamethasone (HY-14648) in human mesenchymal stem cells (HMSCs), upregulating BMP-2 and ActRII gene expression[2].

    In Vivo

    Noggin Protein, Human (0.45-0.9 mg/kg; subcutaneous osmotic pump implantation; 4 weeks) antagonizes BMP4-induced hypertension, vascular NADPH oxidase activation, and endothelial dysfunction in C57BL/6 and apoE-/- mice[5].

    Biological Activity

    1.Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED50 for this effect is <2 μg/mL in the presence of 2000 ng/mL of Recombinant Human BMP-2.
    2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is <10 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.
    3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is <3 ng/mL in the presence of 30 ng/mL of Recombinant Human BMP-4.
    4.Measured by its ability to inhibit BMP-4 induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 10-100ng/mL in the presence of 200 ng/mL of Recombinant Human BMP 4.

    • Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The IC50 is 1.523 ng/mL, corresponding to a specific activity of 6.6×105 units/ mg.
    Species

    Human

    Source

    HEK293

    Tag

    Tag Free

    Accession

    Q13253 (Q28-C232)

    Gene ID
    Molecular Construction
    N-term
    Noggin (Q28-C232)
    Accession # Q13253
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Noggin; NOG
    AA Sequence

    QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

    Predicted Molecular Mass
    23 kDa
    분자량

    Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 2 mM EDTA, pH 7.4.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    선적

    Room temperature in continental US; may vary elsewhere.

    각종 서류
    References

    Noggin Protein, Human (HEK293) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    최근 본 상품:

    온라인 문의

    Your information is safe with us. * Required Fields.

    Noggin Protein, Human (HEK293)

     

    Requested Quantity *

    고객명 *

     

    호칭

    메일주소 *

     

    전화번호 *

    Department

     

    회사명 *

    City

    Country or Region *

         

    비고

    대량구매 문의

    Inquiry Information

    상품명:
    Noggin Protein, Human (HEK293)
    Cat. No.:
    HY-P70558
    수량:
    MCE Japan Authorized Agent: