1. Recombinant Proteins
  2. PF-4/CXCL4 Protein, Human (HEK293)

PF-4/CXCL4 Protein, Human (HEK293)

Cat. No.: HY-P7281
Handling Instructions

PF-4/CXCL4 Protein, Human (HEK293) is a member of the CXC chemokine family, with antiheparin, antiangiogenic properties and inhibits tumor neovascularization.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuPF-4/CXCL4; C-X-C motif chemokine 4; Oncostatin A; SCYB4
Species

Human

Source

HEK 293

Accession

P02776 (E32-S101)

Gene ID

5196

Molecular Weight

Approximately 7.8 kDa

AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Biological Activity
The ED50 is <10 μg/mL as measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

PF-4/CXCL4 is a member of the CXC chemokine family produced by cells of the megakaryocytic lineage. CXCL4 has antiheparin activity, responsible for the important role of CXCL4 in the regulation of coagulation processes. CXCL4 has exhibits antiangiogenic properties in vitro and in vivo and inhibits tumor neovascularization through a variety of mechanisms[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PF-4/CXCL4 Protein, Human (HEK293)
Cat. No.:
HY-P7281
Quantity:
MCE Japan Authorized Agent: