1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. Platelet Factor 4
  6. PF-4/CXCL4 Protein, Human (HEK293)

PF-4/CXCL4 Protein, Human (HEK293)

Cat. No.: HY-P7281
Handling Instructions

PF-4/CXCL4 Protein, Human (HEK293) is a member of the CXC chemokine family, with antiheparin, antiangiogenic properties and inhibits tumor neovascularization.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

PF-4/CXCL4 Protein, Human (HEK293) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PF-4/CXCL4 Protein, Human (HEK293) is a member of the CXC chemokine family, with antiheparin, antiangiogenic properties and inhibits tumor neovascularization.

Background

PF-4/CXCL4 is a member of the CXC chemokine family produced by cells of the megakaryocytic lineage. CXCL4 has antiheparin activity, responsible for the important role of CXCL4 in the regulation of coagulation processes. CXCL4 has exhibits antiangiogenic properties in vitro and in vivo and inhibits tumor neovascularization through a variety of mechanisms[1].

Biological Activity
The ED50 is <10 μg/mL as measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells.
Species

Human

Source

HEK293

Accession

P02776 (E32-S101)

Gene ID
Synonyms
rHuPF-4/CXCL4; C-X-C motif chemokine 4; Oncostatin A; SCYB4
AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Molecular Weight

Approximately 7.8 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PF-4/CXCL4 Protein, Human (HEK293) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PF-4/CXCL4 Protein, Human (HEK293)
Cat. No.:
HY-P7281
Quantity:
MCE Japan Authorized Agent: