TREM-1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The TREM-1 protein is a key cell surface receptor that amplifies inflammatory responses in innate and adaptive immunity. Ligands such as PGLYRP1, HMGB1 or HSP70 activate TREM-1, leading to multimerization and complex formation with TYROBP/DAP12. TREM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The TREM-1 protein is a key cell surface receptor that amplifies inflammatory responses in innate and adaptive immunity. Ligands such as PGLYRP1, HMGB1 or HSP70 activate TREM-1, leading to multimerization and complex formation with TYROBP/DAP12. TREM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TREM-1, a cell surface receptor, assumes pivotal roles in both innate and adaptive immunity by robustly amplifying inflammatory responses. Upon activation by diverse ligands such as PGLYRP1, HMGB1, or HSP70, TREM-1 undergoes multimerization and forms a complex with the transmembrane adapter TYROBP/DAP12. This initiates a SYK-mediated cascade of tyrosine phosphorylation, activating downstream mediators like BTK, MAPK1, MAPK3, or phospholipase C-gamma. Consequently, this cascade facilitates the release of pro-inflammatory cytokines and/or chemokines by neutrophils and macrophages, promoting their migration and thereby amplifying inflammatory responses triggered by bacterial and fungal infections. Beyond microbial interactions, TREM-1 also contributes to the amplification of inflammatory signals initiated by Toll-like receptor (TLR) and NOD-like receptor engagement, playing a crucial role in the pathophysiology of various acute and chronic inflammatory diseases, including septic shock and atherosclerosis. In its monomeric state, TREM-1 forms homomultimers upon activation and interacts with TYROBP/DAP12 and TLR4, further highlighting its intricate involvement in the regulation of immune responses.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9JKE2 (A21-S202)
-
Molecular Construction
-
N-term
-
TREM-1 (A21-S202)
Accession # Q9JKE2 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TREM1; CD354; Triggering Receptor Expressed On Myeloid Cells 1; Triggering Receptor Expressed On Monocytes 1; TREM-1; CD354 Antigen
-
AA Sequence
AIVLEEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTKGSSDVFTPVIIPITRLTERPILITTKYSPSDTTTTRSLPKPTAVVSSPGLGVTIINGTDADSVSTSS
-
Predicted Molecular Mass
20.9 kDa
-
Molecular Weight
Approximately 26-45 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)