1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. TREM-1/CD354
  5. TREM-1 Protein, Mouse (HEK293, His)

TREM-1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70716
COA Handling Instructions

The TREM-1 protein is a key cell surface receptor that amplifies inflammatory responses in innate and adaptive immunity. Ligands such as PGLYRP1, HMGB1 or HSP70 activate TREM-1, leading to multimerization and complex formation with TYROBP/DAP12. TREM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREM-1 Protein, Mouse (HEK293, His) is 182 a.a., with molecular weight of ~38.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $115 In-stock
50 μg $320 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TREM-1 protein is a key cell surface receptor that amplifies inflammatory responses in innate and adaptive immunity. Ligands such as PGLYRP1, HMGB1 or HSP70 activate TREM-1, leading to multimerization and complex formation with TYROBP/DAP12. TREM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREM-1 Protein, Mouse (HEK293, His) is 182 a.a., with molecular weight of ~38.0 kDa.

Background

TREM-1, a cell surface receptor, assumes pivotal roles in both innate and adaptive immunity by robustly amplifying inflammatory responses. Upon activation by diverse ligands such as PGLYRP1, HMGB1, or HSP70, TREM-1 undergoes multimerization and forms a complex with the transmembrane adapter TYROBP/DAP12. This initiates a SYK-mediated cascade of tyrosine phosphorylation, activating downstream mediators like BTK, MAPK1, MAPK3, or phospholipase C-gamma. Consequently, this cascade facilitates the release of pro-inflammatory cytokines and/or chemokines by neutrophils and macrophages, promoting their migration and thereby amplifying inflammatory responses triggered by bacterial and fungal infections. Beyond microbial interactions, TREM-1 also contributes to the amplification of inflammatory signals initiated by Toll-like receptor (TLR) and NOD-like receptor engagement, playing a crucial role in the pathophysiology of various acute and chronic inflammatory diseases, including septic shock and atherosclerosis. In its monomeric state, TREM-1 forms homomultimers upon activation and interacts with TYROBP/DAP12 and TLR4, further highlighting its intricate involvement in the regulation of immune responses.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9JKE2 (A21-S202)

Gene ID

58217  [NCBI]

Molecular Construction
N-term
TREM-1 (A21-S202)
Accession # Q9JKE2
6*His
C-term
Synonyms
Triggering receptor expressed on myeloid cells 1; TREM-1; CD354; Trem1
AA Sequence

AIVLEEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTKGSSDVFTPVIIPITRLTERPILITTKYSPSDTTTTRSLPKPTAVVSSPGLGVTIINGTDADSVSTSS

Molecular Weight

Approximately 38.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TREM-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70716
Quantity:
MCE Japan Authorized Agent: