1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. TROY Protein
  6. TROY/TNFRSF19 Protein, Human (HEK293, Fc)

TROY Protein also known as TAJ, TNFRSF19, a type I transmembrane receptor, is a member of the TNF receptor superfamily. TROY Protein is involved in embryonic development and the development of skin and hair follicles. TROY Protein inhibits cell proliferation in vitro and shows antitumor activity in xenografted models. TROY/TNFRSF19 Protein, Human (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 170 amino acids (M1-L170) and is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TROY Protein also known as TAJ, TNFRSF19, a type I transmembrane receptor, is a member of the TNF receptor superfamily. TROY Protein is involved in embryonic development and the development of skin and hair follicles[1]. TROY Protein inhibits cell proliferation in vitro and shows antitumor activity in xenografted models[2]. TROY/TNFRSF19 Protein, Human (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 170 amino acids (M1-L170) and is produced in HEK293 cells.

Background

TROY Protein shows a unique tissue distribution in the embryo as well as after birth; in the embryo, TROY is exclusively expressed in the epithelium including the neuroepithelium, skin, bronchiolar epithelium, conjunctiva, and so forth, whereas after birth, TROY Protein is strongly expressed in hair follicles like Edar as well as in neurons[1]. TROY Protein is expressed in several invasive cancers, including colorectal cancer, lung cancer, melanoma, nasopharyngeal carcinoma, prostate cancer and GBM[3].
The amino acid sequence of human TROY protein has low homology for mouse TROY protein.
TROY Protein is a growth-promoting signaling molecule that also regulates the NF-κB pathway via interacting with RKIP[2]. In addition, increased TROY expression promotes STAT3 phosphorylation and STAT3 transcriptional activity that is dependent upon JAK1[3]. TROY interacts with LGR5 and inhibits Wnt signaling[4].
Knock-down of TROY suppresses the growth of glioma cells and induces cell cycle arrest at the G1-S phase in U87 cells, significantly decreasing NF-kB luciferase activity[2]. Increased TROY expression increases JAK1 phosphorylation, and silencing TROY expression inhibits GBM cell invasion, and increases sensitivity to temozolomide in glioblastoma[3].

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9NS68-2 (M1-L170)

Gene ID
Molecular Construction
N-term
TROY (M1-L170)
Accession # Q9NS68-2
hFc
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 19; TRADE; TNFRSF19; TROY
AA Sequence

MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTAL

Predicted Molecular Mass
42.5 kDa
Molecular Weight

Approximately 52-57 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TROY/TNFRSF19 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TROY/TNFRSF19 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73573
Quantity:
MCE Japan Authorized Agent: