2. Membrane Transporter/Ion Channel
  3. Sodium Channel
  4. Scorpion toxin Tf2

Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Scorpion toxin Tf2 Chemical Structure

Scorpion toxin Tf2 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Scorpion toxin Tf2 Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials[1].

IC50 & Target

Nav1.3[1]
Molecular Weight

6953.86

Formula

C309H438N80O87S9
Sequence

Lys-Glu-Gly-Tyr-Ala-Met-Asp-His-Glu-Gly-Cys-Lys-Phe-Ser-Cys-Phe-Ile-Arg-Pro-Ser-Gly-Phe-Cys-Asp-Gly-Tyr-Cys-Lys-Thr-His-Leu-Lys-Ala-Ser-Ser-Gly-Tyr-Cys-Ala-Trp-Pro-Ala-Cys-Tyr-Cys-Tyr-Gly-Val-Pro-Ser-Asn-Ile-Lys-Val-Trp-Asp-Tyr-Ala-Thr-Asn-Lys-Cys-NH2 (Disulfide bridge: Cys11-Cys62, Cys15-Cys38, Cys23-Cys43, Cys27-Cys45)
Sequence Shortening

KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC-NH2 (Disulfide bridge: Cys11-Cys62, Cys15-Cys38, Cys23-Cys43, Cys27-Cys45)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Scorpion toxin Tf2 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Scorpion toxin Tf2Scorpion toxin Tf 2Scorpion toxin Tf-2Sodium ChannelNa channelsNa+ channelsScorpion toxin Tf2 is a β-scorpion toxinwhich is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activatorwhich is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials.Inhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Scorpion toxin Tf2
Cat. No.:
HY-P5152
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.