2. Protein Tyrosine Kinase/RTK
  3. Insulin Receptor
  4. GIP, human

GIP, human  (Synonyms: Gastric Inhibitory Peptide (GIP), human)

Cat. No.: HY-P0276 Pureza: 99.94%
COA
SDS
Instrucciones de manejo Technical Support

GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

No. CAS : 100040-31-1

Tamaño Precio Stock Cantidad
1 mg En stock
5 mg En stock
10 mg   Obtener un presupuesto  
50 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Revisión del cliente

Based on 2 publication(s) in Google Scholar

Other Forms of GIP, human:

GIP, human Related Antibodies

Top Publications Citing Use of Products
Histological Imaging/Staining
ELISA
Cell Proliferation/Viability Assay
Flow Cytometry
IF

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP（ 0.1 mg/kg，a single subcutaneous injection） reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days）induced-PCOS C57BL/6J mice.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-7 and 10-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.

    • Actividad biológica

    • Pureza y Documentación

    • Referencias

    • Revisión del cliente

    Descripciòn

    GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion[1][2][3].

    In Vitro

    Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    GIP, human Related Antibodies
    Peso molecular

    4983.60

    Fòrmula

    C226H338N60O66S
    No. CAS
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
    Sequence Shortening

    YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
    Envío

    Room temperature in continental US; may vary elsewhere.
    Almacenamiento

    Sealed storage, away from moisture and light, under nitrogen

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

    Solvente y solubilidad
    In Vitro: 

    H2O : 25 mg/mL (5.02 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2007 mL 1.0033 mL 2.0066 mL
    5 mM 0.0401 mL 0.2007 mL 0.4013 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Calculadora de molaridad

    • Calculadora de dilución

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Pureza y Documentación

    Purity: 99.94%

    SDS (254 KB)

    COA (265 KB) RP-HPLC (253 KB) MS (225 KB) Elemental Analysis Report (122 KB)

    Instrucciones de manejo (2659 KB)
    Referencias

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.2007 mL 1.0033 mL 2.0066 mL 5.0165 mL
    5 mM 0.0401 mL 0.2007 mL 0.4013 mL 1.0033 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    GIP, human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Keywords:

    GIP, human100040-31-1Gastric Inhibitory Peptide (GIP), humanInsulin ReceptorgastricfunctionshormonestimulatorinsulinpostmealsInhibitorinhibitorinhibit

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    Nombre del producto

    		  

    Requested Quantity *

    Nombre del solicitante *

    		 

    Saludo

    Direcciòn del E-mail *

    		 

    Número de teléfono *

    Department

    		 

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

    		      

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    GIP, human
    Cat. No.:
    HY-P0276
    Cantidad:
    MCE Japan Authorized Agent:

    Revisión del cliente

    Thank You for Your Feedback!

    Request for HNMR Report

    Please fill out this form to request the QC report. We will send it to your Email address shortly.

    Your information is safe with us. * Required Fields.

    Nombre del producto

    		  

    Lot #

    Nombre del solicitante *

    		 

    Direcciòn del E-mail *

    Número de teléfono

    		 

    Department *

    Nombre de la Organizaciòn *

    		 

    Country or Region *

    Observaciones

    SAFETY DATA SHEET (SDS)

    English - EN (254 KB) Français - FR (254 KB) Deutsch - DE (254 KB) Norwegian - NO (254 KB) Español - ES (254 KB) Swedish - SV (254 KB) Italian - IT (254 KB) Korean - KR (254 KB) Portuguese - PT (254 KB)

    Request for HNMR Report

    We have received your request and will respond to you as soon as possible.