2. Protein Tyrosine Kinase/RTK
  3. Insulin Receptor
  4. GIP, human

GIP, human  (Synonyms: Gastric Inhibitory Peptide (GIP), human)

Cat. No.: HY-P0276 Pureté: 99.94%
COA
SDS
Instruction de manipulation Technical Support

GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

CAS No. : 100040-31-1

Size Prix Stock Quantité
1 mg En stock
5 mg En stock
10 mg   Obtenir un devis  
50 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 2 publication(s) in Google Scholar

Other Forms of GIP, human:

GIP, human Related Antibodies

Top Publications Citing Use of Products
Histological Imaging/Staining
ELISA
Cell Proliferation/Viability Assay
Flow Cytometry
IF

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP（ 0.1 mg/kg，a single subcutaneous injection） reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days）induced-PCOS C57BL/6J mice.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-7 and 10-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.

    • Activité biologique

    • Pureté et documentation

    • Références

    • Avis client

    Description

    GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion[1][2][3].

    In Vitro

    Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    GIP, human Related Antibodies
    Masse moléculaire

    4983.60

    Formule

    C226H338N60O66S
    CAS No.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
    Sequence Shortening

    YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
    Livraison

    Room temperature in continental US; may vary elsewhere.
    Stockage

    Sealed storage, away from moisture and light, under nitrogen

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

    Solvant et solubilité
    In Vitro: 

    H2O : 25 mg/mL (5.02 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2007 mL 1.0033 mL 2.0066 mL
    5 mM 0.0401 mL 0.2007 mL 0.4013 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Calculateur de molarité

    • Calculateur de dilution

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Pureté et documentation

    Purity: 99.94%

    SDS (254 KB)

    COA (265 KB) RP-HPLC (253 KB) MS (225 KB) Elemental Analysis Report (122 KB)

    Instruction de manipulation (2659 KB)
    Références

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.2007 mL 1.0033 mL 2.0066 mL 5.0165 mL
    5 mM 0.0401 mL 0.2007 mL 0.4013 mL 1.0033 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    GIP, human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Keywords:

    GIP, human100040-31-1Gastric Inhibitory Peptide (GIP), humanInsulin ReceptorgastricfunctionshormonestimulatorinsulinpostmealsInhibitorinhibitorinhibit

    Vos produits récemment consultés:

    Demande en ligne

    Your information is safe with us. * Required Fields.

    Nom du produit

    		  

    Requested Quantity *

    Nom du demandeur *

    		 

    Civilité

    Adresse e-mail *

    		 

    Numéro de téléphone *

    Department

    		 

    Nom de l'organisation *

    City

    État

    Country or Region *

    		      

    Remarques

    Bulk Inquiry

    Inquiry Information

    Nom du produit:
    GIP, human
    Cat. No.:
    HY-P0276
    Quantité:
    MCE Japan Authorized Agent:

    Avis client

    Thank You for Your Feedback!

    Request for HNMR Report

    Please fill out this form to request the QC report. We will send it to your Email address shortly.

    Your information is safe with us. * Required Fields.

    Nom du produit

    		  

    Lot #

    Nom du demandeur *

    		 

    Adresse e-mail *

    Numéro de téléphone

    		 

    Department *

    Nom de l'organisation *

    		 

    Country or Region *

    Remarques

    SAFETY DATA SHEET (SDS)

    English - EN (254 KB) Français - FR (254 KB) Deutsch - DE (254 KB) Norwegian - NO (254 KB) Español - ES (254 KB) Swedish - SV (254 KB) Italian - IT (254 KB) Korean - KR (254 KB) Portuguese - PT (254 KB)

    Request for HNMR Report

    We have received your request and will respond to you as soon as possible.