GIP, human (Synonyms: Gastric Inhibitory Peptide (GIP), human)

Name: GIP, human
Brand: MedChemExpress
SKU: HY-P0276
Rating: 5.0 (2 reviews)

Cat. No.: HY-P0276 Purity: 99.94%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Custom Peptide Synthesis

CAS No. : 100040-31-1

사이즈	재고	수량
1 mg	해외재고보유	Estimated Time of Arrival: December 31
5 mg	해외재고보유	Estimated Time of Arrival: December 31
10 mg	견적 받기
50 mg	견적 받기

or 대량구매 문의

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

고객리뷰

Based on 2 publication(s) in Google Scholar

Other Forms of GIP, human:

GIP, human TFA In-stock

2 Publications Citing Use of MCE GIP, human

Histological Imaging/Staining

ELISA

Cell Proliferation/Viability Assay

Flow Cytometry

: GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]; GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).

: GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]; GIP（ 0.1 mg/kg，a single subcutaneous injection） reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days）induced-PCOS C57BL/6J mice.

: GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]; GIP (10^-7 and 10^-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.

: GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]; GIP (10^-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.

: GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]; GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
순도&문서
References
고객리뷰

제품 설명

In Vitro

Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state^[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

분자량

4983.60

화학식

C₂₂₆H₃₃₈N₆₀O₆₆S

CAS No.

100040-31-1

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Sequence Shortening

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

선적

Room temperature in continental US; may vary elsewhere.

보관

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

용액&용해도

In Vitro:

H₂O : 25 mg/mL (5.02 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2007 mL	1.0033 mL	2.0066 mL
5 mM	0.0401 mL	0.2007 mL	0.4013 mL
10 mM	---	---	---

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

몰농도 계산기
농도 희석 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

순도&문서

Purity: 99.94%

Select Batch:

Data Sheet (286 KB) SDS (254 KB)

COA (265 KB) RP-HPLC (253 KB) MS (225 KB) Elemental Analysis Report (122 KB)

Handling Instructions (2659 KB)

References

[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13. [Content Brief]

[2]. Miyachi A, et al. Quantitative analytical method for determining the levels of gastric inhibitory polypeptides GIP1-42 and GIP3-42 in human plasma using LC-MS/MS/MS. J Proteome Res. 2013;12(6):2690-2699. [Content Brief]

[3]. Gabe MBN, et al. Molecular interactions of full-length and truncated GIP peptides with the GIP receptor - A comprehensive review. Peptides. 2020;125:170224. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2007 mL	1.0033 mL	2.0066 mL	5.0165 mL
H₂O	5 mM	0.0401 mL	0.2007 mL	0.4013 mL	1.0033 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

GIP, human Related Classifications

Metabolic Disease

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GIP, human100040-31-1Gastric Inhibitory Peptide (GIP), humanInsulin ReceptorgastricfunctionshormonestimulatorinsulinpostmealsInhibitorinhibitorinhibit

최근 본 상품:

상품명

Requested Quantity *

고객명 *

호칭

메일주소 *

전화번호 *

Department

회사명 *

City

도

Country or Region *

비고

상품명

Lot #

고객명 *

메일주소 *

전화번호

Department *

회사명 *

Country or Region *

비고

Name
이메일 *

	Sorry, but the email address you supplied was invalid.

GIP, human (Synonyms: Gastric Inhibitory Peptide (GIP), human)

고객리뷰

Other Forms of GIP, human:

GIP, human Related Antibodies

2 Publications Citing Use of MCE GIP, human

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity

순도&문서

References

고객리뷰

GIP, human Related Antibodies

몰농도 계산기

농도 희석 계산기

Complete Stock Solution Preparation Table

GIP, human Related Classifications

Keywords:

최근 본 상품:

고객리뷰

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report