2. Protein Tyrosine Kinase/RTK
  3. Insulin Receptor
  4. GIP, human

GIP, human  (Synonyms: Gastric Inhibitory Peptide (GIP), human)

Art. -Nr.: HY-P0276 Reinheit: 99.94%
COA
SDS
Handling Instructions Technical Support

GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Kundenspezifische Peptidsynthese

CAS. Nr. : 100040-31-1

Größe Preis Verfügbarkeit Menge
1 mg Auf Lager
5 mg Auf Lager
10 mg   Angebot einholen  
50 mg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

This product is a controlled substance and not for sale in your territory.

Kundenbewertung

Based on 2 publication(s) in Google Scholar

Other Forms of GIP, human:

GIP, human Related Antibodies

Top Publications Citing Use of Products
Histological Imaging/Staining
ELISA
Cell Proliferation/Viability Assay
Flow Cytometry
IF

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP（ 0.1 mg/kg，a single subcutaneous injection） reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days）induced-PCOS C57BL/6J mice.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-7 and 10-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.

    GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506.  [Abstract]

    GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.

    • Biologische Aktivität

    • Reinheit & Dokumentation

    • Verweise

    • Kundenbewertung

    Beschreibung

    GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion[1][2][3].

    In Vitro

    Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    GIP, human Related Antibodies
    Molekulargewicht

    4983.60

    Formel

    C226H338N60O66S
    CAS. Nr.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
    Sequence Shortening

    YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
    Versand

    Room temperature in continental US; may vary elsewhere.
    Speicherung

    Sealed storage, away from moisture and light, under nitrogen

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

    Lösungsmittel & Löslichkeit
    In Vitro: 

    H2O : 25 mg/mL (5.02 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2007 mL 1.0033 mL 2.0066 mL
    5 mM 0.0401 mL 0.2007 mL 0.4013 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Molaritätsrechner

    • Verdünnungsrechner

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Reinheit & Dokumentation

    Purity: 99.94%

    SDS (254 KB)

    COA (265 KB) RP-HPLC (253 KB) MS (225 KB) Elemental Analysis Report (122 KB)

    Handling Instructions (2659 KB)
    Verweise

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.2007 mL 1.0033 mL 2.0066 mL 5.0165 mL
    5 mM 0.0401 mL 0.2007 mL 0.4013 mL 1.0033 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    GIP, human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Keywords:

    GIP, human100040-31-1Gastric Inhibitory Peptide (GIP), humanInsulin ReceptorgastricfunctionshormonestimulatorinsulinpostmealsInhibitorinhibitorinhibit

    Ihre kürzlich angesehenen Produkte:

    Online-Anfrage

    Your information is safe with us. * Required Fields.

    Produktname

    		  

    Requested Quantity *

    Name des Antragstellers *

    		 

    Anrede

    E-Mail-Addresse *

    		 

    Telefonnummer *

    Department

    		 

    Name der Organisation *

    City

    Bundesland

    Country or Region *

    		      

    Bemerkungen

    Massenanfrage

    Inquiry Information

    Produktname:
    GIP, human
    Art. -Nr.:
    HY-P0276
    Menge:
    MCE Japan Authorized Agent:

    Kundenbewertung

    Thank You for Your Feedback!

    Request for HNMR Report

    Please fill out this form to request the QC report. We will send it to your Email address shortly.

    Your information is safe with us. * Required Fields.

    Produktname

    		  

    Lot #

    Name des Antragstellers *

    		 

    E-Mail-Addresse *

    Telefonnummer

    		 

    Department *

    Name der Organisation *

    		 

    Country or Region *

    Bemerkungen

    SAFETY DATA SHEET (SDS)

    English - EN (254 KB) Français - FR (254 KB) Deutsch - DE (254 KB) Norwegian - NO (254 KB) Español - ES (254 KB) Swedish - SV (254 KB) Italian - IT (254 KB) Korean - KR (254 KB) Portuguese - PT (254 KB)

    Request for HNMR Report

    We have received your request and will respond to you as soon as possible.