GLP-1(7-36), amide (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide)

Name: GLP-1(7-36), amide
Brand: MedChemExpress
SKU: HY-P0054A
Rating: 5.0 (9 reviews)

Cat. No.: HY-P0054A Pureza: 99.02%: Ficha de datos
COA

SDS
Instrucciones de manejo
FAQs
Technical Support

GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

No. CAS : 107444-51-9

Tamaño	Stock	Cantidad
1 mg	En stock	Estimated Time of Arrival: December 31
5 mg	En stock	Estimated Time of Arrival: December 31
10 mg	En stock	Estimated Time of Arrival: December 31
50 mg	Obtener un presupuesto
100 mg	Obtener un presupuesto

or Consulta para venta a granel

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Revisión del cliente

Based on 9 publication(s) in Google Scholar

Other Forms of GLP-1(7-36), amide:

GLP-1(7-36), amide acetate In-stock
GLP-1(7-36), amide TFA In-stock

9 Publications Citing Use of MCE GLP-1(7-36), amide

Bio/Physico-chemical Assay

Cell Proliferation/Viability Assay

Flow Cytometry

: GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: J Pharm Anal. 2024 Aug;14(8):100968.; GLP-1(7-36), amide acetate, as GLP-1 analogues, facilitated Ca²⁺ mobilization in a dose-dependent manner in GLP-1R-HEK293 cells.

: GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]; TB-59-2 is a potent agonist in the cAMP assay with a similar EC₅₀ as the GLP-1(7-36), amide acetate (30 min) peptide.

: GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]; TB01-3 competed with GLP-1(7-36), amide acetate peptide for binding and inhibited the activities of TB01-3 binding in the absence and presence of GLP-1(7-36), amide acetate.

: GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321. [Abstract]; GCs were isolated from the ovaries of PCOS model mice (day 54 of life) and treated with increasing doses of GLP-1(7-36), amide acetate (10, 100, and 1000 nM; 24-120 h). Cell viability was measured by CCK-8 assay. The results showed that 100 nM GLP-1(7-36), amide acetate significantly enhanced the viability of MGCs compared with the blank control group.

: GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321. [Abstract]; Flow cytometry Annexin V-FITC/PI double staining was used to detect the apoptotic rate of PCOS MGCs in control group and GLP-1(7-36), amide acetate (10 nM, 100 nM, and 1000 nM) treated for 48 hours. The results showed that different concentrations of GLP-1(7-36), amide acetate inhibited the apoptosis of PCOS-associated MGCs treated by DHEA. After being treated for 48 hours, the percentage of apoptotic and late-apoptotic cells was 11.97%, 0.343%, 0.152%, and 1.162%, corresponding to the concentration of GLP-1(7-36), amide acetate of 0, 10, 100, and 1000 nM.

: GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321. [Abstract]; Bcl-2, bax, and beta-actin were detected using their specific antibodies by the Western blot analysis for the PCOS MGCs with or without 100 nM GLP-1(7-36), amide acetate interference for 48 hours. The results showed that the expression of bcl-2 protein increased significantly after GLP-1(7-36), amide acetate intervention, while the expression of Bax decreased.

Recomendaciones destacadas

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Actividad biológica
Protocolo
Pureza y Documentación
Referencias
Revisión del cliente

Descripciòn

GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.

In Vitro

The sequence of Glucagon-Like Peptide after residue 7 shows similarities to glucagon and to other biologically active members of the secretin peptide family, particularly glucose-dependent insulinotropic peptide (GIP). This sequence has been especially well preserved, showing 66% nucleotide homology with GLP-1 in the proglucagon of the very primitive anglerfish. This 7-36 sequence of GLP-1 is a potent insulin-releasing peptide in vitro^[1]. Glucagon-Like Peptide (GLP) I (7-36), amide is a product of the tissue-specific post-translational processing of the glucagon precursor. It is released postprandially from intestinal endocrine L cells and stimulates insulin secretion. DPP IV is the main degradation enzyme for GLP-l(7 - 36)amide in human serum. Dipeptidyl-peptidase IV can initiate the metabolism of GIP and GLP-1(7-36)amide in human serum^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Glucagon-Like Peptide (GLP) I (7-36), amide is a physiological incretin hormone that is released after nutrient intake from the lower gut and stimulates insulin secretion at elevated plasma glucose concentrations. Exogenous GLP-1 (7-36 amide) is an effective means of normalizing fasting plasma glucose concentrations in poorly-controlled Type 2 diabetic subjects^[3]. Exogenously administered GLP-1-(7–36)amide is extremely labile in vivo, with more than 80% being cleaved into GLP-1-(9–36)amide after sc or iv administration^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Peso molecular

3297.68

Fòrmula

C₁₄₉H₂₂₆N₄₀O₄₅

No. CAS

107444-51-9

Appearance

Solid

Color

White to off-white

Sequence

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvente y solubilidad

In Vitro:

H₂O : 100 mg/mL (30.32 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.3032 mL	1.5162 mL	3.0324 mL
5 mM	0.0606 mL	0.3032 mL	0.6065 mL
10 mM	0.0303 mL	0.1516 mL	0.3032 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Calculadora de molaridad
Calculadora de dilución

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Pureza y Documentación

Purity: 99.90%

Select Batch:

Ficha de datos (273 KB) SDS (252 KB)

COA (243 KB) RP-HPLC (252 KB) MS (71 KB)

Instrucciones de manejo (2659 KB)

Referencias

[1]. Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4. [Content Brief]

[2]. Mentlein R, et al. Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum. Eur J Biochem. 1993 Jun 15;214(3):829-35. [Content Brief]

[3]. Nauck MA, et al. Normalization of fasting hyperglycaemia by exogenous glucagon-like peptide 1 (7-36 amide) in type 2 (non-insulin-dependent) diabetic patients. Diabetologia. 1993 Aug;36(8):741-4. [Content Brief]

[4]. Hansen L, et al. Glucagon-like peptide-1-(7-36)amide is transformed to glucagon-like peptide-1-(9-36)amide by dipeptidyl peptidase IV in the capillaries supplying the L cells of the porcine intestine. Endocrinology. 1999 Nov;140(11):5356-63. [Content Brief]

Ensayo celular
^[4]

To test whether there is GLP-1-degrading activity in the perfusion medium itself, synthetic Glucagon-Like Peptide (GLP) I (7-36), amide is incubated (30 min at 37°C) in vitro with medium collected from the arterial line (i.e. before it passed through the tissue) and from the venous line, and subjected to HPLC and RIA analysis ^[4].

MCE no ha confirmado la precisión de estos métodos independientemente. Son solo para referencia.

Referencias

[1]. Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4. [Content Brief]

[2]. Mentlein R, et al. Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum. Eur J Biochem. 1993 Jun 15;214(3):829-35. [Content Brief]

[3]. Nauck MA, et al. Normalization of fasting hyperglycaemia by exogenous glucagon-like peptide 1 (7-36 amide) in type 2 (non-insulin-dependent) diabetic patients. Diabetologia. 1993 Aug;36(8):741-4. [Content Brief]

[4]. Hansen L, et al. Glucagon-like peptide-1-(7-36)amide is transformed to glucagon-like peptide-1-(9-36)amide by dipeptidyl peptidase IV in the capillaries supplying the L cells of the porcine intestine. Endocrinology. 1999 Nov;140(11):5356-63. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.3032 mL	1.5162 mL	3.0324 mL	7.5811 mL
	5 mM	0.0606 mL	0.3032 mL	0.6065 mL	1.5162 mL
	10 mM	0.0303 mL	0.1516 mL	0.3032 mL	0.7581 mL
	15 mM	0.0202 mL	0.1011 mL	0.2022 mL	0.5054 mL
	20 mM	0.0152 mL	0.0758 mL	0.1516 mL	0.3791 mL
	25 mM	0.0121 mL	0.0606 mL	0.1213 mL	0.3032 mL
	30 mM	0.0101 mL	0.0505 mL	0.1011 mL	0.2527 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

GLP-1(7-36), amide Related Classifications

Metabolic Disease

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GLP-1(7-36), amide107444-51-9Glucagon-like peptide-1 (GLP-1)(7-36), amide Human GLP-1 (7-36), amideGCGRGlucagon ReceptorInhibitorinhibitorinhibit

Productos vistos recientemente:

Nombre del producto

Requested Quantity *

Nombre del solicitante *

Saludo

Direcciòn del E-mail *

Número de teléfono *

Department

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

Observaciones

Nombre del producto

Lot #

Nombre del solicitante *

Direcciòn del E-mail *

Número de teléfono

Department *

Nombre de la Organizaciòn *

Country or Region *

Observaciones

Name
E-mail *

	Sorry, but the email address you supplied was invalid.

GLP-1(7-36), amide (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide)

Revisión del cliente

Other Forms of GLP-1(7-36), amide:

GLP-1(7-36), amide Related Antibodies

9 Publications Citing Use of MCE GLP-1(7-36), amide

Recomendaciones destacadas

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Actividad biológica

Protocolo

Pureza y Documentación

Referencias

Revisión del cliente

GLP-1(7-36), amide Related Antibodies

Calculadora de molaridad

Calculadora de dilución

Complete Stock Solution Preparation Table

GLP-1(7-36), amide Related Classifications

Keywords:

Productos vistos recientemente:

Revisión del cliente

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report