1. GPCR/G Protein
  2. GCGR
  3. Glucagon-like peptide 1 (1-37), human

Glucagon-like peptide 1 (1-37), human  (Synonyms: GLP-1 (1-37) human)

Cat. No.: HY-P1145 Pureté: 99.70%
Instruction de manipulation Technical Support

Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

Glucagon-like peptide 1 (1-37), human

Glucagon-like peptide 1 (1-37), human Chemical Structure

CAS No. : 87805-34-3

Size Prix Stock Quantité
500 μg En stock
1 mg En stock
5 mg En stock
10 mg En stock
50 mg   Obtenir un devis  
100 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 1 publication(s) in Google Scholar

Other Forms of Glucagon-like peptide 1 (1-37), human:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Glucagon-like peptide 1 (1-37), human

  • Activité biologique

  • Protocole

  • Pureté et documentation

  • Références

  • Avis client

Description

Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.

IC50 & Target

GLP-1 receptor[1]

Cellular Effect
Cell Line Type Value Description References
HEK293 EC50
0.09 1
Compound: GLP-1
Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP response element (MRE/CRE)-driven reporter gene assay
Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP response element (MRE/CRE)-driven reporter gene assay
[PMID: 22103243]
In Vitro

Glucagon-like peptide-1 (GLP-1) is produced by the posttranslational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with 94.7% of the initial amount of peptide left after a 4h exposure to mouse serum. GLP-1(1-37) is confirmed to be a highly potent agonist of the GLP-1 receptor (GLP-1R) by measuring the expression of the luciferase reporter gene expression in transiently transfected human embryonic kidney (HEK293) cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GLP-1(1–37) decreased glycemic excursion in a dose-dependent. The administration of GLP-1(1–37) or GLP-1(7–37) markedly decrease blood glucose levels at 15 min and 30 min compared with the control group[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Masse moléculaire

4169.48

Formule

C186H275N51O59

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Sequence Shortening

HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Pureté et documentation
Références
Test cellulaire
[1]

HEK293 cells (5×104) are seeded in a 96-well plate and transiently cotransfected with the GLP-1R plasmid and the CRE-luciferase reporter plasmid. After a 48 h transfection, different concentrations of GLP-1(1–37) or GLP-1(7–37) are added, and the cells are incubated for 5 h. The cells are harvested for a luciferase assay using a luciferase assay[1].

MCE n'a pas confirmé de manière indépendante l'exactitude de ces méthodes. Ils sont pour référence seulement.

Administration animale
[1]

Mice[1]

The normal KM mice are fasted for 16 h before the administration (i.p.) of GLP-1 and glucose. GLP-1(1-37) (25 nmol/kg) with or without exendin(9-39) (250 nmol/kg) is given in combination with glucose (4 g/kg). GLP-1(7-37) (25 nmol/kg) with or without exendin(9-39) (250 nmol/kg) is also administrated in combination with glucose (4 g/kg). The control group is treated with saline (NaCl, 9 g/l) and glucose (4 g/kg). The IPGTT is carried out at 0, 15, 30 and 60 min after glucose and protein administration, and the blood glucose levels are measured as described above[1].

MCE n'a pas confirmé de manière indépendante l'exactitude de ces méthodes. Ils sont pour référence seulement.

Références
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Calculateur de molarité

  • Calculateur de dilution

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Nom du produit

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Glucagon-like peptide 1 (1-37), human
Cat. No.:
HY-P1145
Quantité:
MCE Japan Authorized Agent: