1. MAPK/ERK Pathway
  2. JNK


Cat. No.: HY-P0069A
Handling Instructions

L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK. Sequence: Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2;DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

L-JNKI-1 Chemical Structure

L-JNKI-1 Chemical Structure

Size Price Stock Quantity
1 mg USD 180 In-stock
Estimated Time of Arrival: December 31
5 mg USD 360 In-stock
Estimated Time of Arrival: December 31
10 mg USD 540 In-stock
Estimated Time of Arrival: December 31
50 mg USD 1380 In-stock
Estimated Time of Arrival: December 31
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

View All JNK Isoform Specific Products:

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References


L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK. Sequence: Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2;DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2.

IC50 & Target



In Vivo

L-JNKI-1 has been shown to effectively inhibit JNK activity in in vivo studies. It is shown that Ang II induces a dose-dependent pressor response, which was significantly attenuated by JNK inhibition[1]. It is also found that 10 μM L-JNKI-1 decreases phosphorylated c-Jun by 98% and phosphorylated Elk-1 by 100%. L-JNKI-1 is able to across the blood-brain barrier and penetrate neurons of adult mice and P5 rats within 1 h after an intraperitoneal injection[2].

Solvent & Solubility
In Vitro: 

10 mM in DMSO

Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2616 mL 1.3081 mL 2.6161 mL
5 mM 0.0523 mL 0.2616 mL 0.5232 mL
10 mM 0.0262 mL 0.1308 mL 0.2616 mL
*Please refer to the solubility information to select the appropriate solvent.
Animal Administration

Six-week-old male SD rats are used. The rats are injected with a bolus of JNK peptide inhibitor L-JNKI-1 (5 mg/kg) followed by infusion of JNKI 1 (5 mg/kg per hour) until the completion of the experiment. After a 30-minute infusion of JNK inhibitor, the pressor response to Ang II at the 3 doses described above is determined at 30-minute intervals[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight





Please store the product under the recommended conditions in the Certificate of Analysis.


Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name



Applicant name *


Email address *

Phone number *


Organization name *

Country or Region *


Requested quantity *


Bulk Inquiry

Inquiry Information

Product Name:
Cat. No.:


Cat. No.: HY-P0069A