L-JNKI-1
Based on 2 publication(s) in Google Scholar
L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.
For research use only. We do not sell to patients.
- Purity : 99.97%
- Formula: C164H286N66O40
- Molecular Weight:3822.44
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) L-JNKI-1
More
Biological Activity
Description
IC50 & Target
[1]|
JNK |
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3822.44
-
Formula C164H286N66O40
-
Color White to off-white
-
Sequence
Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2
-
Sequence Shortening
DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
PLoS One
Hypothermia but not NMDA receptor antagonism protects against stroke induced by distal middle cerebral arterial occlusion in mice. [Abstract]2020 Mar 3;15(3):e0229499. PMID: 32126102 -
Neuroreport
Stroke injury induced by distal middle cerebral artery occlusion is resistant to N-methyl-d-aspartate receptor antagonism in FVB/NJ mice. [Abstract]2021 Sep 8;32(13):1122-1127. PMID: 34284452
Solvent & Solubility
In Vitro:
H2O : ≥ 100 mg/mL (26.16 mM)
* "≥" means soluble, but saturation unknown.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
In Vivo:
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 100 mg/mL (26.16 mM); Clear solution; Need ultrasonic
Purity & Documentation
-
Data Sheet (271 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Zhou MS, et al. Role of c-Jun N-terminal kinase in the regulation of vascular tone. J Cardiovasc Pharmacol Ther. 2010 Mar;15(1):78-83. [Content Brief]
[2]. Borsello T, et al. A peptide inhibitor of c-Jun N-terminal kinase protects against excitotoxicity and cerebral ischemia. Nat Med. 2003 Sep;9(9):1180-6. [Content Brief]
Complete Stock Solution Preparation Table
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2616 mL | 1.3081 mL | 2.6161 mL | 6.5403 mL |
| 5 mM | 0.0523 mL | 0.2616 mL | 0.5232 mL | 1.3081 mL | |
| 10 mM | 0.0262 mL | 0.1308 mL | 0.2616 mL | 0.6540 mL | |
| 15 mM | 0.0174 mL | 0.0872 mL | 0.1744 mL | 0.4360 mL | |
| 20 mM | 0.0131 mL | 0.0654 mL | 0.1308 mL | 0.3270 mL | |
| 25 mM | 0.0105 mL | 0.0523 mL | 0.1046 mL | 0.2616 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
L-JNKI-1 Related Classifications
HY-P0069A Related Classifications
Powered by Bioz