1. MAPK/ERK Pathway
  2. JNK
  3. L-JNKI-1

L-JNKI-1 

Cat. No.: HY-P0069A
Handling Instructions

L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

L-JNKI-1 Chemical Structure

L-JNKI-1 Chemical Structure

Size Price Stock Quantity
1 mg USD 180 In-stock
Estimated Time of Arrival: December 31
5 mg USD 360 In-stock
Estimated Time of Arrival: December 31
10 mg USD 540 In-stock
Estimated Time of Arrival: December 31
50 mg USD 1380 In-stock
Estimated Time of Arrival: December 31
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

View All JNK Isoform Specific Products:

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.

IC50 & Target

JNK

 

In Vivo

L-JNKI-1 has been shown to effectively inhibit JNK activity in in vivo studies. It is shown that Ang II induces a dose-dependent pressor response, which was significantly attenuated by JNK inhibition[1]. It is also found that 10 μM L-JNKI-1 decreases phosphorylated c-Jun by 98% and phosphorylated Elk-1 by 100%. L-JNKI-1 is able to across the blood-brain barrier and penetrate neurons of adult mice and P5 rats within 1 h after an intraperitoneal injection[2].

Molecular Weight

3822.44

Formula

C₁₆₄H₂₈₆N₆₆O₄₀

Sequence

Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2

Sequence Shortening

DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2

Shipping

Room temperature in continental US; may vary elsewhere

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
References
Animal Administration
[1]

Rats[1]
Six-week-old male SD rats are used. The rats are injected with a bolus of JNK peptide inhibitor L-JNKI-1 (5 mg/kg) followed by infusion of JNKI 1 (5 mg/kg per hour) until the completion of the experiment. After a 30-minute infusion of JNK inhibitor, the pressor response to Ang II at the 3 doses described above is determined at 30-minute intervals[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
L-JNKI-1
Cat. No.:
HY-P0069A
Quantity: