1. GPCR/G Protein
  2. Neuropeptide Y Receptor

Pancreatic Polypeptide, human (Synonyms: Human pancreatic polypeptide)

Cat. No.: HY-P0199
Handling Instructions

Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Pancreatic Polypeptide, human Chemical Structure

Pancreatic Polypeptide, human Chemical Structure

CAS No. : 75976-10-2

Size Price Stock
500 μg USD 220 Get quote
1 mg USD 380 Get quote
5 mg USD 1500 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.

IC50 & Target

Neuropeptide Y (NPY) Y4/Y5 receptor[1]

In Vitro

Human pancreatic polypeptide (hPP) is one such peptide, being released postprandially from F cells of the pancreatic islets depending on caloric load, food consumption and circadian rhythm. It is a C-terminally amidated 36 amino acid peptide with a characteristic hairpin-like pancreatic polypeptide (PP)-fold and acts at the Y4 receptor to induce satiety and delay gastric emptying and motility[1]. Addition of the human pancreatic polypeptide (hPP) (10 nM-1 μM) results in a significant, dose-dependent reduction in both basal and stimulated release. Human pancreatic polypeptide (hPP) can also inhibit basal and stimulated NPY release with a pharmacological profile suggesting a role for Y4 presynaptic receptors[2].

Solvent & Solubility
In Vitro: 

10 mM in H2O

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2391 mL 1.1957 mL 2.3914 mL
5 mM 0.0478 mL 0.2391 mL 0.4783 mL
10 mM 0.0239 mL 0.1196 mL 0.2391 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

4181.71

Formula

C₁₈₅H₂₈₇N₅₃O₅₄S₂

CAS No.

75976-10-2

Sequence

Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2

Sequence Shortening

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pancreatic Polypeptide, human
Cat. No.:
HY-P0199
Quantity:

Pancreatic Polypeptide, human

Cat. No.: HY-P0199