2. Signaling Pathways
  3. Membrane Transporter/Ion Channel
    Neuronal Signaling
  4. iGluR

iGluR

Ionotropic glutamate receptors

iGluR

Related Products

PDF 3.65 MB

iGluR (ionotropic glutamate receptor) is a ligand-gated ion channel that is activated by the neurotransmitter glutamate. iGluR are integral membrane proteins compose of four large subunits that form a central ion channel pore. Sequence similarity among all known glutamate receptor subunits, including the AMPA, kainate, NMDA, and δ receptors.

AMPA receptors are the main charge carriers during basal transmission, permitting influx of sodium ions to depolarise the postsynaptic membrane. NMDA receptors are blocked by magnesium ions and therefore only permit ion flux following prior depolarisation. This enables them to act as coincidence detectors for synaptic plasticity. Calcium influx through NMDA receptors leads to persistent modifications in the strength of synaptic transmission.

iGluR Isoform Specific Products:

iGluR Isoform Comparison
Cat. No. Product Name Effect Purity Chemical Structure
  • HY-19465
    Dasolampanel
    		Antagonist
    Dasolampanel is a kainate receptor antagonist that helps regulate the excitability of the nervous system by blocking kainate receptors and reducing glutamate-mediated excitatory transmission. Dasolampanel can be used in the study of diseases such as overexcitement and sleep disorders.
    Dasolampanel
  • HY-12881R
    Eliprodil (Standard)
    		Antagonist
    Eliprodil (Standard) is the analytical standard of Eliprodil. This product is intended for research and analytical applications. 0
    Eliprodil (Standard)
  • HY-12882AR
    Ifenprodil tartrate (Standard)
    		Antagonist
    Ifenprodil (tartrate) (Standard) is the analytical standard of Ifenprodil (tartrate). This product is intended for research and analytical applications. Ifenprodil tartrate is a typical noncompetitive NMDA receptor antagonist. Ifenprodil tartrate exerts high affinity at NR1A/NR2B receptors (IC50=0.34 μM) over 400-fold than at NR1A/NR2A receptors (IC50=146 μM). Ifenprodil tartrate inhibits GIRK (Kir3), reduces inward currents through the basal GIRK activity. Ifenprodil tartrate has the potential to be a cerebral vasodilator.
    Ifenprodil tartrate (Standard)
  • HY-100457R
    IC87201 (Standard)
    		Inhibitor
    IC87201 (Standard) is the analytical standard of IC87201 (HY-100457). This product is intended for research and analytical applications. IC87201, an inhibitor of PSD95-nNOS protein-protein interactions, suppresses NMDAR-dependent NO and cGMP formation.
    IC87201 (Standard)
  • HY-107605
    UBP296
    		Antagonist
    UBP296 is a potent and selective antagonist of GLUK5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.
    UBP296
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
    		Antagonist
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-N1593
    15-Methoxypinusolidic acid
    15-Methoxypinusolidic acid (compound 1) is a labdane diterpene compound isolated from the leaves of Calocedrus microlepic.
    15-Methoxypinusolidic acid
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
    		Antagonist
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
Cat. No. Product Name / Synonyms Application Reactivity
iGluR Isoform Comparison

Your Search Returned No Results.

Sorry. There is currently no product that acts on isoform together.

Please try each isoform separately.