VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.

For research use only. We do not sell to patients.

  • CAS No.: 2279952-25-7
  • Formula: C171H250N40O39
  • Molecular Weight:3490.06
  • Storage:

    Please store the product under the recommended conditions in the Certificate of Analysis.

  • Biological Activity
  • Chemical Information
  • Purity & Documentation
  • References
  • Help & FAQs

Publications Citing Use of MedChemExpress (MCE) VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

More
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00