2. Antibodies
  3. Primary Antibodies
  4. Monoclonal Antibodies Recombinant Antibodies
  5. Glucose Transporter GLUT2 Antibody (YA2669)

Glucose Transporter GLUT2 Antibody (YA2669)

Cat. No.: HY-P82924
User Guide for Antibodies Technical Support

Glucose Transporter GLUT2 Antibody (YA2669) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to Glucose Transporter GLUT2.

Para uso exclusivo en investigación. No vendemos a pacientes.

Tamaño Precio Stock Cantidad
20 μL Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μL Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μL Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
250 μL   Obtener un presupuesto  
Synthetic products have potential research and development risk.
or Consulta para venta a granel

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • WB: Western Blot;
  • IHC-P: Immunohistochemistry-Paraffin;
  • IHC-F: Immunohistochemistry-Frozen;
  • ICC/IF: Immunocytochemistry/Immunofluorescence;
  • IF-Tissue: Immunofluorescence-Tissue;
  • mIHC: Multiplex Immunohistochemical;
  • IP: Immunoprecipitation;
  • ChIP: Chromatin Immunoprecipitation;
  • FC: Flow Cytometry;
  • ELISA: Enzyme Linked Immunosorbent Assay

  • Product Detail

  • Background

  • Descripciòn

Descripciòn

Glucose Transporter GLUT2 Antibody (YA2669) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to Glucose Transporter GLUT2.
Host

Rabbit
Clonality

Recombinant, Monoclonal
Peso molecular
Predicted band size: 57 kDa;
Observed band size: 57 kDa
Note: Due to possible protein modifications or aggregation, the molecular weight should be confirmed by actual measurement, and the predicted value is for reference only.
Species Reactivity
Human
SwissProt ID
Gene ID
Immunogen

A synthesized peptide derived from human GLUT2 IISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAE  aa38-83.
Application &
Dilution Ratio
Application Dilution Ratio
WB
WB: Western Blot
1:500-1:1000
Sensitivity Endogenous Pureza Affinity Chromatography
Conjugation Non-conjugated Modification Unmodified
Isotype IgG  
Appearance

Liquid
Formulation

Supplied in rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Storage & Stability

Stored at -20°C for 1 year. Avoid repeated freeze / thaw cycles.
Envío

Shipping with blue ice.
Background
Function：Facilitative hexose transporter that mediates the transport of glucose, fructose and galactose (PubMed:16186102, PubMed:23396969, PubMed:28083649, PubMed:8027028, PubMed:8457197). Likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell (PubMed:8027028). May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney (PubMed:3399500). Also able to mediate the transport of dehydroascorbate (PubMed:23396969)
Subcellular Localization：Cell membrane; Multi-pass membrane protein
Expression：
Tissue_specificity:Liver, insulin-producing beta cells, small intestine, and kidneys
Isoforms & Post-Translational Modification：P11168 has 2 isomers: P11168-1: 57490 Da (predicted); P11168-2: 44702 Da (predicted).
N-glycosylated; required for stability and retention at the cell surface of pancreatic beta cells
Database

Entrez Gene: 6514 Human

SwissProt: P11168 Human

OMIM: 227810 Human

Research Field

Signal Transduction
Synonyms
liver; Glucose Transporter 2; Glucose Transporter GLUT2; Glucose transporter type 2; Glucose transporter; liver/islet; GLUT2; GTT2; SLC2A2
Documentación
User Guide for Antibodies (1077 KB)

Glucose Transporter GLUT2 Antibody (YA2669) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Nombre del producto

  

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

      

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Glucose Transporter GLUT2 Antibody (YA2669)
Cat. No.:
HY-P82924
Cantidad:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nombre del producto

  

Lot #

Nombre del solicitante *

 

Country or Region *

Direcciòn del E-mail *

     

Número de teléfono *

 

Nombre de la Organizaciòn *

Observaciones

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.