1. GPCR/G Protein
    Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Galanin (1-29)(rat, mouse) TFA

Galanin (1-29)(rat, mouse) TFA 

Cat. No.: HY-P1132A
Handling Instructions

Galanin (1-29)(rat, mouse) TFA is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively. Anticonvulsant effect.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Galanin (1-29)(rat, mouse) TFA Chemical Structure

Galanin (1-29)(rat, mouse) TFA Chemical Structure

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of Galanin (1-29)(rat, mouse) TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Galanin (1-29)(rat, mouse) TFA is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively. Anticonvulsant effect[1][2].

Molecular Weight

3278.47

Formula

C₁₄₃H₂₁₂F₃N₄₃O₄₃

Sequence

Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Sequence Shortening

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Galanin (1-29)(rat, mouse)Neuropeptide Y ReceptorNPY receptorsubtypeneuropeptidenervoussystemsanticonvulsantInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galanin (1-29)(rat, mouse) TFA
Cat. No.:
HY-P1132A
Quantity:
MCE Japan Authorized Agent: