Galanin (1-29)(rat, mouse)
Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect.
For research use only. We do not sell to patients.
- CAS No.: 114547-31-8
- Formula: C141H211N43O41
- Molecular Weight:3164.45
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
All Neuropeptide Y Receptor Isoforms
More
Biological Activity
Chemical Information
-
CAS No. 114547-31-8
-
Molecular Weight 3164.45
-
Formula C141H211N43O41
-
Sequence
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
-
Sequence Shortening
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Wang S, et al. Cloning and expressional characterization of a novel galanin receptor. Identification of different pharmacophores within galanin for the three galanin receptor subtypes. J Biol Chem. 1997;272(51):31949-31952. [Content Brief]
[2]. Mazarati A, et al. Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 2006;318(2):700-708. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Galanin (1-29)(rat, mouse) Related Classifications
HY-P1132 Related Classifications
Powered by Bioz