Galanin (2-29) (rat)
Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM).
Para uso exclusivo en investigación. No vendemos a pacientes.
- No. CAS: 141696-11-9
- Fòrmula: C139H208N42O40
- Peso molecular:3107.40
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
Ver todos los productos específicos de isoformas Neuropeptide Y Receptor
More
Actividad biológica
Descripciòn
Chemical Information
-
No. CAS 141696-11-9
-
Peso molecular 3107.40
-
Fòrmula C139H208N42O40
-
Synonyms
Rat galanin(2-29)
-
Sequence
Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
-
Sequence Shortening
WTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocolo
-
CCK-8/WST-8 Cell Proliferation Assay
The CCK-8/WST-8 assay is based on the reduction of the water-soluble tetrazolium salt WST-8 to a water-soluble formazan product by cellular dehydrogenases in metabolically active cells, where the generated formazan amount is proportional to the number of living cells and is quantified by measuring absorbance in the visible range, providing a colorimetric readout for cell viability and proliferation assessment. This class of tetrazolium-based assays improves upon earlier MTT-based systems by producing a water-soluble formazan, eliminating the need for organic solubilization steps and enabling direct spectrophotometric measurement in culture medium.
Pureza y Documentación
Referencias
[1]. Rossowski WJ, et al. Galanin: structure-dependent effect on pancreatic amylase secretion and jejunal strip contraction. Eur J Pharmacol. 1993 Aug 24;240(2-3):259-67. [Content Brief]
[2]. Wang S, et al. Molecular cloning and pharmacological characterization of a new galanin receptor subtype. Mol Pharmacol. 1997 Sep;52(3):337-43. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)