Pancreatic polypeptide 

Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion^[1].

Pancreatic polypeptid (PP) (0.1?μM, 48 h) causes a significant reduction in growth inhibitory hormone secretion in mHippo E18 cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Pancreatic polypeptid (PP)(1?μM, Hippocampal injection, 0.2?μL/min followed by 3?min) stimulates the expression of the neuronal activation marker c-Fos in growth inhibitor-containing cells in the male B6C3F1/J mice brain, indicating that it activates growth inhibitor-containing cells in the mouse hippocampus^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4182.70

C₁₈₅H₂₈₆N₅₂O₅₅S₂

59763-91-6

Solid

White to off-white

Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

• [1]. Wook Kim, et al. Pancreatic polypeptide inhibits somatostatin secretion. FEBS Lett. 2014 Aug 25;588(17):3233-9.  [Content Brief]