Psalmotoxin 1 (Synonyms: PcTx1; Psalmopoeus cambridgei toxin-1)

Name: Psalmotoxin 1
Brand: MedChemExpress
SKU: HY-P1411
Rating: 5.0 (6 reviews)

Art. -Nr.: HY-P1411 Reinheit: 99.02%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC₅₀: 0.9 nM) by increasing the apparent affinity for H⁺ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Kundenspezifische Peptidsynthese

Psalmotoxin 1 Chemische Struktur

CAS. Nr. : 880107-52-8

Größe	Preis	Verfügbarkeit	Menge
100 μg		Auf Lager	Estimated Time of Arrival: December 31

or Massenanfrage

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

This product is a controlled substance and not for sale in your territory.

Kundenbewertung

Based on 6 publication(s) in Google Scholar

Other Forms of Psalmotoxin 1:

Psalmotoxin 1 TFA In-stock

6 Publications Citing Use of MCE Psalmotoxin 1

Spezialitätsempfehlungen

•Related Small Molecules:

•Related Proteins:

Alle Sodium Channel Isoform-spezifische Produkte anzeigen:

Alle Isoformen anzeigen

Na_v1.1 Na_v1.2 Na_v1.3 Na_v1.4 Na_v1.5 Na_v1.6 Na_v1.7 Na_v1.8 Na_v1.9

Biologische Aktivität
Reinheit & Dokumentation
Verweise
Kundenbewertung

Beschreibung

IC₅₀ & Target

IC50: 0.9 nM (ASIC1a), 50 nM (ASIC1b, ASIC2a, and ASIC3)^[6].

In Vitro

Psalmotoxin 1 (20 nM, 125 s) inhibits ASIC1a currents by drastically shifting the steady-state desensitization curve to lower H⁺ concentrations^[1].
? Psalmotoxin 1 (30 nM) competes with Ca²⁺ in binding to ASIC1a channels^[1].
? Psalmotoxin 1 (100 or 200 ng, 24-72 h) significantly weakens the migration, proliferation and invasion of MCF-7 and MDA-MB-231 cells^[4].
? Psalmotoxin 1 (100 ng/mL, 24 h) significantly inhibits acid-induced increases in intracellular calcium and LDH release, induces cell apoptosis and cell cycle arrest in nucleus pulposus cells (NPCs)^[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay^[4]

Cell Line:	MCF-7 and MDA-MB-231 cells
Concentration:	100 or 200 ng
Incubation Time:	24, 48, 72 h
Result:	Inhibited the cell migration, proliferation and invasion of breast cancer cells.

Western Blot Analysis^[5]

Cell Line:	Nucleus pulposus cells (NPCs)
Concentration:	100 ng/mL
Incubation Time:	24 h
Result:	Decreased Bax and cleaved caspase-3 expression, and increased Bcl-2 expression.

In Vivo

Psalmotoxin 1 (i.c.v., 1 ng/kg, a single dose) is neuroprotective in a conscious model of stroke via direct inhibition of ASIC1a^[2].
? Psalmotoxin 1 (tail vein injection, 10 ng/kg, daily for 7 days) inhibits tumor growth in breast cancer mice model^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Male spontaneously hypertensive rats (SHR)^[2]
Dosage:	1 ng/kg, a single dose.
Administration:	Intracerebroventricular (i.c.v.) injection
Result:	Reduced cortical and striatal infarct volumes measured 72 h post-stroke. Reduced the severity of motor deficit at 1 and 3 days after stroke compared to control rats. Displayed an anti-apoptotic effect in the occluded hemisphere (reduced stroke-induced caspase-3 positive cells).

Animal Model:	Female nude BALB/C mice (orthotopic implantation, MCF-7 and MDA-MB-231 cells)^[3]
Dosage:	10 ng/kg, daily for 7 days.
Administration:	Tail vein injection
Result:	Inhibited breast tumor growth.

Molekulargewicht

4689.39

Formel

C₂₀₀H₃₁₂N₆₂O₅₇S₆

CAS. Nr.

880107-52-8

Appearance

Solid

Color

White to off-white

Sequence

Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)

Sequence Shortening

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)

Versand

Room temperature in continental US; may vary elsewhere.

Speicherung

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Lösungsmittel & Löslichkeit

In Vitro:

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Reinheit & Dokumentation

Purity: 99.02%

Select Batch:

Data Sheet (270 KB) SDS (252 KB)

COA (260 KB) RP-HPLC (113 KB) MS (211 KB)

Handling Instructions (2659 KB)

Verweise

[1]. Chen X, et al. The tarantula toxin psalmotoxin 1 inhibits acid-sensing ion channel (ASIC) 1a by increasing its apparent H⁺ affinity. J Gen Physiol. 2005 Jul;126(1):71-9. [Content Brief]

[2]. Claudia A McCarthy, et al. PcTx1 affords neuroprotection in a conscious model of stroke in hypertensive rats via selective inhibition of ASIC1a. Neuropharmacology. 2015 Dec;99:650-7. [Content Brief]

[3]. Niko Joeres, et al. Functional and pharmacological characterization of two different ASIC1a/2a heteromers reveals their sensitivity to the spider toxin PcTx1. Sci Rep. 2016 Jun 9;6:27647. doi: 10.1038/srep27647. [Content Brief]

[4]. Chao Yang, et al. Overexpression of acid-sensing ion channel 1a (ASIC1a) promotes breast cancer cell proliferation, migration and invasion. Transl Cancer Res. 2020 Dec;9(12):7519-7530. [Content Brief]

[5]. Feng Cai, et al. Acid-sensing ion channel 1a regulates the survival of nucleus pulposus cells in the acidic environment of degenerated intervertebral discs. Iran J Basic Med Sci. 2016 Aug;19(8):812-820. [Content Brief]

[6]. P Escoubas, et al. Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. J Biol Chem. 2000 Aug 18;275(33):25116-21. [Content Brief]

Psalmotoxin 1 Related Classifications

Molaritätsrechner
Verdünnungsrechner

Die Formel zur Berechnung von Molaritäten

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Konzentration _{(Stammlösung)} × Volumen _{(Stammlösung)} = Konzentration _{(Ziellösung)} × Volumen _{(Ziellösung)}

Diese Gleichung wird häufig abgekürzt als: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Ihre kürzlich angesehenen Produkte:

Produktname

Requested Quantity *

Name des Antragstellers *

Anrede

E-Mail-Addresse *

Telefonnummer *

Department

Name der Organisation *

City

Bundesland

Country or Region *

Bemerkungen

Produktname

Lot #

Name des Antragstellers *

E-Mail-Addresse *

Telefonnummer

Department *

Name der Organisation *

Country or Region *

Bemerkungen

Name
Email *

	Sorry, but the email address you supplied was invalid.

Psalmotoxin 1 (Synonyms: PcTx1; Psalmopoeus cambridgei toxin-1)

Kundenbewertung

Other Forms of Psalmotoxin 1:

Psalmotoxin 1 Related Antibodies

6 Publications Citing Use of MCE Psalmotoxin 1

Spezialitätsempfehlungen

•Related Small Molecules:

•Related Proteins:

Alle Sodium Channel Isoform-spezifische Produkte anzeigen:

Biologische Aktivität

Reinheit & Dokumentation

Verweise

Kundenbewertung

Psalmotoxin 1 Related Antibodies

Psalmotoxin 1 Related Classifications

Molaritätsrechner

Verdünnungsrechner

Die Formel zur Berechnung von Molaritäten

The dilution calculator equation

Keywords:

Ihre kürzlich angesehenen Produkte:

Kundenbewertung

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report