1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. ALK-4/Activin RIB
  6. Activin RIB/ALK-4 Protein, Rat (HEK293, Fc)

Activin RIB, also known as activin receptor type-1B (ACVR1B) or ALK-4, is a type I transmembrane serine/threonine kinase receptor that is part of the TGF-β receptor superfamily. Activin binds to a type II activin receptor (ACVR2or ACVR2B) and then recruits ACVR1B. Activin RIB/ALK-4 Protein, Rat (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 126 amino acids (M1-E126).

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Activin RIB, also known as activin receptor type-1B (ACVR1B) or ALK-4, is a type I transmembrane serine/threonine kinase receptor that is part of the TGF-β receptor superfamily. Activin binds to a type II activin receptor (ACVR2or ACVR2B) and then recruits ACVR1B[1][2][3]. Activin RIB/ALK-4 Protein, Rat (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 126 amino acids (M1-E126).

Background

ALK4, also termed activin A receptor type 1b (ACVR1B), is a transmembrane serine/threonine kinase activin type-I receptor and is highly expressed in the mammal heart. ALK4 is an important regulator of vertebrate development, with roles in mesoderm induction, primitive streak formation, gastrulation, dorsoanterior patterning, and left-right axis determination[1][2].
The sequence of amino acids in ALK4 (ACVR1B) proteins from different species is very stable, which leads to the conclusion that in the process of evolution, ALK4 has been only slightly altered, and that both in humans and in animals, its function is similar.
Activin binds to a type II activin receptor (Acvr2 or Acvr2b) and then recruits ACVR1B. ALK4 (ACVR1B) forms an activin receptor complex with activin type-II receptor to transduce activin signal from the cell surface to the cytoplasm, thus regulating physiological and pathological processes including embryogenesis, tissue homeostasis, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. Receptor heterodimerization activates the type II receptor kinase to phosphorylate the type I receptor, which recruits and phosphorylates regulated Smads2 and 3. Phosphorylated regulated Smads are released and form a heteromeric complex with the Co-Smad, Smad4. The regulated Smad and Co-Smad complex then translocates to the nucleus where it regulates the expression of many genes. In mammals, Acvr1b is expressed by various types of epithelial cells, including interfollicular epidermis, and the outer root sheath (ORS) and the inner root sheath (IRS) of the hair follicles. Activin signaling through Acvr1b acts on skin epithelial cells in a paracrine manner[1][2][3].
ALK4 (ACVR1B), is an important regulator of vertebrate development, with roles in mesoderm induction, primitive streak formation, gastrulation, dorsoanterior patterning, and left-right axis determination. ALK4 also regulates physiological and pathological processes including embryogenesis, tissue homeostasis, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. ALK4 functions as a tumor-suppressor gene in pancreatic tumorigenesis[1][2][3][4].

In Vitro

Recombinant ALK4 (25-5 ng) and recombinant PTP1B together at 3°C resultes in the apparent cleavage of PTP1B. PTP1B is cleaved after 3 min of Activin treatment, suggesting that Activin causes an interaction between ALK4 and PTP1B that leads to the cleavage of PTP1B by ALK4[5].

Biological Activity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized Rat Activin RIB at 10 μg/mL (100 μL/well) can bind Rat TDGF. The ED50 for this effect is 100.6 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat Activin RIB at 10 μg/mL (100 μL/well) can bind Rat TDGF. The ED50 for this effect is 100.6 ng/mL.
Assay Procedure

Materials
Biotin
Pre-chilled sterile water
Wash buffer: 1X PBST
Blocking buffer: 1% BSA in PBST
TMB substrate solution: Mix substrate solutions A and B in a 1:1 ratio immediately before use
Stop solution (2M H2SO4)

Assay Procedure
Biotinylation
1. Dissolution of Biotin reagent: Remove Biotin from -10 to -30℃ and immediately dissolve 1 vial of Biotin in 180 μL of cold distilled water. Gently pipette up and down to mix, yielding a 10 mM Biotin solution.
2. Calculate the volume of EZ-LinkTM Sulfo-NHS-LC-LC-Biotin, No-WeighTM Format to be added.
3. Incubate at room temperature in the dark for 45 minutes;
4. Quantification of biotinylated protein: Use the BCA assay to quantify the protein concentration. The concentration of biotinylated TDGF1 is 1118 μg/mL.

Biotinylation
1. Coating: Dilute Recombinant Rat Activin RIB protein to 10 μg/mL in 1X PBS, 100 μL per well, and incubate overnight at 4℃.
2. Washing: Wash the plate with wash buffer, 260 μL per well, wash once, pat dry.
3. Blocking: Block with 1% BSA in 1X PBST (blocking buffer), 150 μL per well, at 25℃ with shaking at 450 rpm for 4 hours.
4. Dilute Biotinylated TDGF1 to the following concentrations: 0, 0.1, 0.2, 1, 2, 10, 20, 100, 200, 1000, 2000, 10000, 20000 ng/mL.
5. Add Biotinylated TDGF1: 100 μL per well, incubate at 25℃ with shaking at 450 rpm for 2 hours.
6. Washing: Wash the plate with wash buffer, 260 μL per well, wash 5 times, with each wash lasting 1 minute, then pat dry.
7. Add secondary antibody: Dilute the secondary antibody at a 1:2000 ratio, add 100 μL per well; incubate at 25℃ with shaking at 450 rpm for 1 hour.
8. Washing: Wash the plate with wash buffer, 260 μL per well, wash 3 times, with each wash lasting 1 minute, then pat dry.
9. Add TMB substrate solution: 100 μL per well; incubate at room temperature in the dark for 15 minutes.
10. Terminate the reaction: Add 2 M H2SO4, 100 μL per well.
11. Plate reading: Read at 450 nm.
12. Use GraphPad Prism software to plot a curve with the OD value as the y-axis and the Biotinylated TDGF1 protein concentration as the x-axis, then calculate the ED50 value.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P80202 (S24-E126)

Gene ID
Molecular Construction
N-term
ACVR1B (S24-E126)
Accession # P80202
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Activin Receptor IB; ALK-4; Activin RIB; ACVR1B
AA Sequence

SGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPEHPSMWGPVE

분자량

Approximately 38-45 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Activin RIB/ALK-4 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Activin RIB/ALK-4 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P76718
수량:
MCE Japan Authorized Agent: