1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin Like 3 Proteins
  5. ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His-Avi)

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P78379
Handling Instructions Technical Support

ANGPTL3/angiopoietin-like 3 protein is a hepatic factor that complexly regulates lipid and glucose metabolism.It stimulates plasma triglycerides by inhibiting lipoprotein lipase (LPL), inhibits TG clearance through PCSK6 and FURIN recruitment, is independent of proteolytic cleavage, and is not affected by GPIHBP1.ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His-Avi) is the recombinant human-derived ANGPTL3/Angiopoietin-like 3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPTL3/angiopoietin-like 3 protein is a hepatic factor that complexly regulates lipid and glucose metabolism.It stimulates plasma triglycerides by inhibiting lipoprotein lipase (LPL), inhibits TG clearance through PCSK6 and FURIN recruitment, is independent of proteolytic cleavage, and is not affected by GPIHBP1.ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His-Avi) is the recombinant human-derived ANGPTL3/Angiopoietin-like 3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The ANGPTL3/Angiopoietin-like 3 protein functions as a hepatokine, intricately involved in the regulation of lipid and glucose metabolism. Proposed to play a role in directing energy substrates towards storage or oxidative tissues in response to food intake, ANGPTL3 stimulates plasma triglycerides (TG) by inhibiting lipoprotein lipase (LPL) activity, leading to suppressed TG clearance. This effect is achieved through the recruitment of proprotein convertases PCSK6 and FURIN to LPL, resulting in cleavage and dissociation of LPL from the cell surface. Interestingly, this regulatory function does not require ANGPTL3 proteolytic cleavage, is mediated by the N-terminal domain, and remains unaffected by GPIHBP1. Additionally, ANGPTL3 inhibits endothelial lipase, elevating plasma levels of high-density lipoprotein (HDL) cholesterol and phospholipids. By binding to adipocytes, it activates lipolysis, releasing free fatty acids and glycerol. ANGPTL3 selectively suppresses LPL in oxidative tissues, directing very low-density lipoprotein (VLDL)-TG to white adipose tissue (WAT) for storage in response to food, potentially cooperating with circulating, liver-derived ANGPTL8, and ANGPTL4 expression in WAT. It also contributes to lower plasma levels of low-density lipoprotein (LDL)-cholesterol independently of the canonical APOE and LDLR pathway. Moreover, ANGPTL3 may stimulate hypothalamic LPL activity, while in vitro, it inhibits LPL activity without effectiveness on GPIHBP1-stabilized LPL.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q9Y5C1 (S17-K219)

Gene ID
Molecular Construction
N-term
ANGPTL3 (S17-K219)
Accession # Q9Y5C1
8*His-Avi
C-term
Protein Length

Partial

Synonyms
ANGPTL3; ANGPT5; ANG-5; Angiopoietin-5; FHBL2; ANL3; Angiopoietin-5; Angiopoietin-like Protein 3
AA Sequence

SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSK

Predicted Molecular Mass
26.6 kDa
Molecular Weight

Approximately 30-38 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P78379
Quantity:
MCE Japan Authorized Agent: