Animal-Free IL-1 alpha Protein, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-1 alpha Protein, Mouse (His) is 156 a.a., with molecular weight of ~18.93 kDa.

The cytokine interleukin-1 alpha (IL-1 alpha), present constitutively intracellularly in almost all quiescent non-hematopoietic cells, serves a crucial role in inflammation and acts as a bridge between the innate and adaptive immune systems. Upon binding to its receptor IL1R1, in conjunction with its accessory protein IL1RAP, it forms the high-affinity interleukin-1 receptor complex. Subsequent signaling events involve the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4, leading to the activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha functions as an alarmin, and upon cell death, it is released into the extracellular space following cell membrane disruption, inducing inflammation and signaling host response to injury or damage. Beyond its role as a danger signal released during cell necrosis, IL-1 alpha also directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. Additionally, IL-1 alpha interacts with various proteins, including TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Its interaction with IL1R1 and S100A13 further contributes to its intricate regulatory mechanisms, with the latter being a crucial step in the export of IL-1 alpha, involving direct translocation of the complex across the plasma membrane.

Measure by its ability to induce D10.G4.1 cells proliferation. The ED₅₀ for this effect is <5 pg/mL. The specific activity of recombinant mouse IL-1 alpha is > 2 x 10⁸ IU/mg.

Mouse

E. coli

C-His

P01582 (S115-S270)

16175  [NCBI]

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Approximately 18.93 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.