1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Erythrocyte CD Proteins Dendritic Cell CD Proteins Pattern Recognition Receptors
  4. DC-SIGN/CD299 C-type Lectin Receptors
  5. DC-SIGN
  6. CD299 Protein, Human (HEK293, Fc)

CD299 Protein, Human (HEK293, Fc)

Cat. No.: HY-P76219
COA Handling Instructions

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, Fc) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CD299 Protein, Human (HEK293, Fc) is 322 a.a., with molecular weight (glycosylation form) of 65.83 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $84 In-stock
10 μg $143 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

CD299 Protein, Human (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, Fc) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CD299 Protein, Human (HEK293, Fc) is 322 a.a., with molecular weight (glycosylation form) of 65.83 kDa.

Background

CD299, a gene encoding a C-type lectin, plays crucial roles in cell adhesion and pathogen recognition. This receptor has broad specificity, recognizing a diverse array of pathogens with significant public health implications, including tuberculosis mycobacteria, Ebola, hepatitis C, HIV-1, influenza A, West Nile virus, and the SARS-CoV acute respiratory syndrome coronavirus. The protein structure comprises four distinct domains: a C-terminal carbohydrate recognition domain, a variable-length flexible tandem-repeat neck domain, a transmembrane region, and an N-terminal cytoplasmic domain involved in internalization. CD299 shares close sequence and functional similarities with its neighboring gene, CD209 (also known as DC-SIGN), though they differ in viral recognition and expression patterns. CD299 exhibits high expression in endothelial cells of the liver, lymph nodes, and placenta. Notably, polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection. With biased expression observed in tissues such as the liver (RPKM 15.4) and lymph nodes (RPKM 9.8), CD299 emerges as a critical player in immune response and pathogen defense.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9H2X3-1/NP_055072.3 (S78-E399)

Gene ID
Molecular Construction
N-term
hFc
CD299 (S78-E399)
Accession # NP_055072.3
C-term
Synonyms
C-type lectin domain family 4 member M; DC-SIGNR; DC-SIGN2; L-SIGN; CD299; CLEC4M; CD209L
AA Sequence

SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Weight

65.83 KDa, due to glycosylation

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD299 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76219
Quantity:
MCE Japan Authorized Agent: