1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Erythrocyte CD Proteins Dendritic Cell CD Proteins Pattern Recognition Receptors
  4. DC-SIGN2/CLEC4M/CD299 C-type Lectin Receptors
  5. CD299 Protein, Human (HEK293, hFc, solution)

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, hFc, solution) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, hFc, solution) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CD299, a gene encoding a C-type lectin, plays crucial roles in cell adhesion and pathogen recognition. This receptor has broad specificity, recognizing a diverse array of pathogens with significant public health implications, including tuberculosis mycobacteria, Ebola, hepatitis C, HIV-1, influenza A, West Nile virus, and the SARS-CoV acute respiratory syndrome coronavirus. The protein structure comprises four distinct domains: a C-terminal carbohydrate recognition domain, a variable-length flexible tandem-repeat neck domain, a transmembrane region, and an N-terminal cytoplasmic domain involved in internalization. CD299 shares close sequence and functional similarities with its neighboring gene, CD209 (also known as DC-SIGN), though they differ in viral recognition and expression patterns. CD299 exhibits high expression in endothelial cells of the liver, lymph nodes, and placenta. Notably, polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection. With biased expression observed in tissues such as the liver (RPKM 15.4) and lymph nodes (RPKM 9.8), CD299 emerges as a critical player in immune response and pathogen defense.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9H2X3-1/NP_055072.3 (S78-E399)

Gene ID
Molecular Construction
N-term
hFc
CD299 (S78-E399)
Accession # NP_055072.3
C-term
Protein Length

Partial

Synonyms
C-type lectin domain family 4 member M; DC-SIGNR; DC-SIGN2; L-SIGN; CD299; CLEC4M; CD209L
AA Sequence

SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Weight

65.83 KDa, due to glycosylation

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD299 Protein, Human (HEK293, hFc, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD299 Protein, Human (HEK293, hFc, solution)
Cat. No.:
HY-P76219
Quantity:
MCE Japan Authorized Agent: