CD299 Protein, Human (HEK293, hFc, solution)

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, hFc, solution) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, hFc, solution) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CD299, a gene encoding a C-type lectin, plays crucial roles in cell adhesion and pathogen recognition. This receptor has broad specificity, recognizing a diverse array of pathogens with significant public health implications, including tuberculosis mycobacteria, Ebola, hepatitis C, HIV-1, influenza A, West Nile virus, and the SARS-CoV acute respiratory syndrome coronavirus. The protein structure comprises four distinct domains: a C-terminal carbohydrate recognition domain, a variable-length flexible tandem-repeat neck domain, a transmembrane region, and an N-terminal cytoplasmic domain involved in internalization. CD299 shares close sequence and functional similarities with its neighboring gene, CD209 (also known as DC-SIGN), though they differ in viral recognition and expression patterns. CD299 exhibits high expression in endothelial cells of the liver, lymph nodes, and placenta. Notably, polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection. With biased expression observed in tissues such as the liver (RPKM 15.4) and lymph nodes (RPKM 9.8), CD299 emerges as a critical player in immune response and pathogen defense.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • CD299 (S78-E399)
      Accession # NP_055072.3
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CLEC4M; Dendritic Cell-Specific ICAM-3-Grabbing Non-Integrin 2; Prev. CD209L; DC-SIGN-Related Protein; Prev. CD299; L-SIGN; DC-SIGNR; Liver/Lymph Node-Specific ICAM-3 Grabbing Non-Integrin; DC-SIGN2; Liver/Lymph Node-Specific ICAM-3-Grabbing Non-Integrin;

  • AA Sequence

    SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

  • Predicted Molecular Mass

    65 kDa

  • Molecular Weight

    Approximately 66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00