Copy Link Print Information

CD7 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (HEK293, His) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD7 Protein, Human (HEK293, His)
  • CD7 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (HEK293, His) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD7 Protein, although its precise function remains elusive, is identified to interact with SECTM1. The nature of this interaction suggests a potential role for CD7 in cellular processes that involve SECTM1, emphasizing the need for further research to unravel the specific functions and molecular pathways in which CD7 is intricately involved. The current lack of detailed information underscores the ongoing exploration required to elucidate the functional significance of CD7 and its interplay with SECTM1 in cellular contexts.

Verified Bioactivity

Immobilized Anti-Human CD7 Antibody (GRI_bio, Research Grade) at 1 μg/mL (100 μL/well) can bind Recombinant Human CD7(C-6His).The ED50 of Recombinant Human CD7(C-6His) is 1-100 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P09564 (A26-P180)

  • Gene ID
    924  [NCBI]
  • Molecular Construction
    • N-term
    • CD7 (A26-P180)
      Accession # P09564
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD7; LEU-9; CD7 Molecule; Tp40; T-Cell Antigen CD7; T-Cell Surface Antigen Leu-9; GP40; CD7 Antigen (P41); TP41; P41 Protein; T-Cell Leukemia Antigen; CD7 Antigen

  • AA Sequence

    AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

  • Predicted Molecular Mass

    17.5 kDa

  • Molecular Weight

    Approximately 26-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • CD7 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD7 Protein, Human (HEK293, His)
  • CD7 Protein, Human (HEK293, His) Product Image