1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Biotinylated Proteins
  3. CD7 NK Cell CD Proteins Macrophage CD Proteins
  4. CD7 Protein, Human (Biotinylated, HEK293, His-Avi)

CD7 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72361
Handling Instructions Technical Support

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

CD7 Protein, although its precise function remains elusive, is identified to interact with SECTM1. The nature of this interaction suggests a potential role for CD7 in cellular processes that involve SECTM1, emphasizing the need for further research to unravel the specific functions and molecular pathways in which CD7 is intricately involved. The current lack of detailed information underscores the ongoing exploration required to elucidate the functional significance of CD7 and its interplay with SECTM1 in cellular contexts.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

P09564 (A26-P180)

Gene ID

924  [NCBI]

Molecular Construction
N-term
CD7 (A26-P180)
Accession # P09564
6*His-Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
T-Cell Antigen CD7; GP40; T-Cell Leukemia Antigen; T-Cell Surface Antigen Leu-9; TP41
AA Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Predicted Molecular Mass
19.3 kDa
Molecular Weight

Approximately 30-35 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD7 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD7 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD7 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72361
Quantity:
MCE Japan Authorized Agent: