CD7 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.
The functional role of CD7 protein is currently not fully elucidated, and its specific cellular activities remain unknown. However, it has been identified to interact with SECTM1, suggesting potential involvement in cellular processes mediated by this interaction. Further research is required to comprehensively understand the functional significance and biological activities associated with CD7 protein in cellular contexts.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P50283 (Q24-P150)
-
Molecular Construction
-
N-term
-
CD7 (Q24-P150)
Accession # P50283 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD7; LEU-9; CD7 Molecule; Tp40; T-Cell Antigen CD7; T-Cell Surface Antigen Leu-9; GP40; CD7 Antigen (P41); TP41; P41 Protein; T-Cell Leukemia Antigen; CD7 Antigen
-
AA Sequence
QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFP
-
Predicted Molecular Mass
15.1 kDa
-
Molecular Weight
Approximately 18-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
