Ephrin-A1/EFNA1 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The Ephrin-A1/EFNA1 protein is a cell surface GPI-binding ligand of the Eph receptor and is involved in migration, repulsion, and adhesion during development. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The Ephrin-A1/EFNA1 protein is a cell surface GPI-binding ligand of the Eph receptor and is involved in migration, repulsion, and adhesion during development. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.
Background
Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, assumes a crucial role in orchestrating migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Functioning as a promiscuous binder, Ephrin-A1 engages Eph receptors on adjacent cells, facilitating contact-dependent bidirectional signaling. Its significance extends to angiogenesis and tumor neovascularization, where the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2 is pivotal for EFNA1-induced RAC1 GTPase activation, vascular endothelial cell migration, and assembly. Furthermore, Ephrin-A1 exerts anti-oncogenic effects by activating and down-regulating EPHA2, inducing its internalization and degradation. In the context of gliomas, Ephrin-A1 acts as a negative regulator, down-regulating EPHA2 and FAK, thereby mitigating the tumorigenesis process. Beyond its role in angiogenesis and tumorigenesis, Ephrin-A1 can elicit the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as a monomer or homodimer, Ephrin-A1 forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases, including EPHA1, underscoring its diverse molecular interactions.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Ephrin-A1 at 10μg/mL (100 μL/well) can bind biotinylated EPHA2 Protein. The ED50 for this effect is 4.986 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P97553 (A18-H181)
-
Molecular Construction
-
N-term
-
EFNA1 (A18-H181)
Accession # P97553 -
His
-
C-term
-
-
Protein Length
Full Length of Ephrin-A1 Chain
-
Synonyms
EFNA1; GMAN; Prev. TNFAIP4; Tumor Necrosis Factor Alpha-Induced Protein 4; Prev. EPLG1; TNF Alpha-Induced Protein 4; EPH-Related Receptor Tyrosine Kinase Ligand 1; LERK-1; Ephrin-A1; Tumor Necrosis Factor, Alpha-Induced Protein 4; LERK1; Epididymis Secret
-
AA Sequence
ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGH
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)