Ephrin-A1/EFNA1 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Ephrin-A1/EFNA1 protein is a cell surface GPI-binding ligand of the Eph receptor and is involved in migration, repulsion, and adhesion during development. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Ephrin-A1/EFNA1 protein is a cell surface GPI-binding ligand of the Eph receptor and is involved in migration, repulsion, and adhesion during development. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, assumes a crucial role in orchestrating migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Functioning as a promiscuous binder, Ephrin-A1 engages Eph receptors on adjacent cells, facilitating contact-dependent bidirectional signaling. Its significance extends to angiogenesis and tumor neovascularization, where the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2 is pivotal for EFNA1-induced RAC1 GTPase activation, vascular endothelial cell migration, and assembly. Furthermore, Ephrin-A1 exerts anti-oncogenic effects by activating and down-regulating EPHA2, inducing its internalization and degradation. In the context of gliomas, Ephrin-A1 acts as a negative regulator, down-regulating EPHA2 and FAK, thereby mitigating the tumorigenesis process. Beyond its role in angiogenesis and tumorigenesis, Ephrin-A1 can elicit the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as a monomer or homodimer, Ephrin-A1 forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases, including EPHA1, underscoring its diverse molecular interactions.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Ephrin-A1 at 10μg/mL (100 μL/well) can bind biotinylated EPHA2 Protein. The ED50 for this effect is 4.986 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Ephrin-A1 at 10 μg/mL (100 μL/well) can bind biotinylated EPHA2 Protein. The ED50 for this effect is 4.986 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EFNA1 (A18-H181)
      Accession # P97553
    • His
    • C-term
  • Protein Length

    Full Length of Ephrin-A1 Chain

  • Synonyms

    EFNA1; GMAN; Prev. TNFAIP4; Tumor Necrosis Factor Alpha-Induced Protein 4; Prev. EPLG1; TNF Alpha-Induced Protein 4; EPH-Related Receptor Tyrosine Kinase Ligand 1; LERK-1; Ephrin-A1; Tumor Necrosis Factor, Alpha-Induced Protein 4; LERK1; Epididymis Secret

  • AA Sequence

    ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGH

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00