Ephrin-A1/EFNA1 Protein, Rat (HEK293, His)

The Ephrin-A1/EFNA1 protein is a cell surface GPI-binding ligand of the Eph receptor and is involved in migration, repulsion, and adhesion during development. Ephrin-A1/EFNA1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-His labeled tag.

Ephrin-A1/EFNA1 protein, a cell surface GPI-bound ligand for Eph receptors, assumes a crucial role in orchestrating migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Functioning as a promiscuous binder, Ephrin-A1 engages Eph receptors on adjacent cells, facilitating contact-dependent bidirectional signaling. Its significance extends to angiogenesis and tumor neovascularization, where the recruitment of VAV2, VAV3, and the PI3-kinase p85 subunit by phosphorylated EPHA2 is pivotal for EFNA1-induced RAC1 GTPase activation, vascular endothelial cell migration, and assembly. Furthermore, Ephrin-A1 exerts anti-oncogenic effects by activating and down-regulating EPHA2, inducing its internalization and degradation. In the context of gliomas, Ephrin-A1 acts as a negative regulator, down-regulating EPHA2 and FAK, thereby mitigating the tumorigenesis process. Beyond its role in angiogenesis and tumorigenesis, Ephrin-A1 can elicit the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Existing as a monomer or homodimer, Ephrin-A1 forms heterodimers with EPHA2 and binds to a spectrum of receptor tyrosine kinases, including EPHA1, underscoring its diverse molecular interactions.

Measured by its binding ability in a functional ELISA. Immobilized Ephrin-A1 at 10μg/mL (100 μL/well) can bind biotinylated EPHA2 Protein. The ED₅₀ for this effect is 4.986 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Ephrin-A1 at 10 μg/mL (100 μL/well) can bind biotinylated EPHA2 Protein. The ED₅₀ for this effect is 4.986 ng/mL.

Rat

HEK293

C-His

P97553 (A18-H181)

94268  [NCBI]

Partial

ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGH

Approximately 23 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.