Ephrin-B2/EFNB2 Protein, Mouse (HEK293, His)
Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Ephrin-B2/EFNB2 Protein is a cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases that play crucial roles in neuronal, vascular, and epithelial development. It binds to neighboring cells' Eph receptors, leading to contact-dependent bidirectional signaling. This interaction triggers forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. Ephrin-B2/EFNB2 binds promiscuously to receptor tyrosine kinases such as EPHA4, EPHA3, and EPHB4. It cooperates with EPHB4 to regulate cell adhesion, migration, heart morphogenesis, and angiogenesis. Additionally, it participates in guiding the orientation of longitudinally projecting axons and interacts with PDZRN3 (By similarity).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P52800 (R29-A232)
-
Molecular Construction
-
N-term
-
EFNB2 (R29-A232)
Accession # P52800 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EFNB2; Eph-Related Receptor Tyrosine Kinase Ligand 5; Prev. EPLG5; MGC126226; Ephrin-B2; MGC126227; LERK5; MGC126228; HTKL; EPH-Related Receptor Tyrosine Kinase Ligand 5; HTK Ligand; LERK-5; Htk-L; HTK-L; Ephrin B2; Ligand Of Eph-Related Kinase 5
-
AA Sequence
RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA
-
Predicted Molecular Mass
23.5 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
