Exodus-2/CCL21 Protein, Human (sf9)

Exodus-2/CCL21 Protein, Human (sf9) is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Human (sf9) is a recombinant human Exodus-2/CCL21 (S24-P134) expressed by Sf9 insect cells^[1].

CCL21, also known as exodus-2 and secondary lymphoid chemokine (SLC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 9 in the human genome. It binds to glycosaminoglycan (GAG) and is anchored to the surface of endothelial cells. As a chemokine, CCL21 inhibits hematopoiesis and stimulates chemotaxis, and is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages or neutrophils. At the same time, CCL21 is a potent stimulator of T cell migration and adhesion, binding to the glycoprotein PSGL-1 on T cells to promote the migration of T cells to secondary lymphoid organs. CCL21 can act through chemokine receptors CCR7 and CXCR3. Among them, CCR7 is a GPCR that is normally expressed by T cell subsets central memory cells, thymic T cells, B cells, mature DCs and other rare cell subsets. ccl21 can function as a microglia activator in the CNS and is expressed exclusively in endangered or mechanically damaged neurons^[1][2].

CCL21(.1 µg/mL, 2 h) can interact with polysialic acid to regulate the migratory capacity of human dendritic cells^[3].

Measured by its binding ability in a functional ELISA. Immobilized Exodus-2/CCL21 Protein, Human (sf9) at 2 μg/mL (100 μl/well) can bind human IGFBP7 with a linear range of 0.16-4 μg/mL.

Human

Sf9 insect cells

Tag Free

O00585 (S24-P134)

6366  [NCBI]

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Approximately 18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 40 mM Tris, 0.3 M NaCl, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Balsam Rizeq, et al. The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers (Basel). 2020 Apr 23;12(4):1036.  [Content Brief]

  [2]. Knut Biber, et al. Neuronal CCL21 up-regulates microglia P2X4 expression and initiates neuropathic pain development. EMBO J. 2011 May 4;30(9):1864-73.  [Content Brief]

  [3]. Marieke Bax, et al. Interaction of polysialic acid with CCL21 regulates the migratory capacity of human dendritic cells. PLoS One. 2009 Sep 14;4(9):e6987.  [Content Brief]