1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 1
  6. IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)

IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)

Cat. No.: HY-P73245
Instrucciones de manejo Technical Support

IFN-alpha 13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway, exerts function by inhibiting viral replication as well as modulating immune response. IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His) is produced in P.pastoris yeast cells with a C-Terminal His tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

IFN-alpha 13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His) is produced in P.pastoris yeast cells with a C-Terminal His tag.

Background

IFN-alpha 13 (IFNA1; IFN-α1), belongs to the alpha/beta interferon family, is produced by macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
IFNs binds to one of three type-specific receptors, which leads to the activation of JAK1 and TYK2[3]. This signal transduction results in phosphorylation of STAT1 and STAT2 and eventually in an association with IFN regulatory factor 9 (IRF9) and formation of the IFN-stimulated gene factor 3 (ISGF3) complex. Thus the ISGF3 complex induces transcription of IFN-stimulated genes (ISGs), with subsequent immunomodulatory effects on both innate and adaptive immune responses[4].
The interactions of type I IFN with the immune system is important for the generation of a durable antitumor response through its effects on dendritic cells (DC)[5]. IFN has been widely used for animal disease model, and the sequence of amino acids in IFNA1 protein of human is very different from mouse (62.96%).

In Vitro

IFN-alpha induces highly active dendritic cells (DC) rapidly generated from blood monocytes in vitro, suitable for therapeutic vaccination of cancer research[5].

Species

Human

Source

P. pastoris

Tag

C-His

Accession

P01562 (C24-E189)

Gene ID

3439  [NCBI]/3447  [NCBI]

Molecular Construction
N-term
IFNA1 (C24-E189)
Accession # P01562
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-1/13; IFN-alpha-1/13; LeIF D; IFNA1; IFNA13
AA Sequence

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Predicted Molecular Mass
20.8 kDa
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación
Referencias

IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P73245
Cantidad:
MCE Japan Authorized Agent: