IFN-gamma R1/CD119 Protein, Human (HEK293, His)

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate^[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)^[2]. IFN-gamma R1/CD119 Protein, Human (228a.a, HEK293, His) is a recombinant human IFN-gamma R1 (E18-G245) with C-terminal 6*His tag, which is produced in HEK293 cells.

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 is constitutively expressed on the surface of almost all cells^[1].
IFN-gamma R1 can associate with IFN-gamma R2 to form a functional receptor. Upon binding with IFN-gamma, IFNγR1 and IFNγR2 oligomerize and transphosphorylate^[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. The phosphorylation of IFNγR1 creates a docking site for STAT1 and leads to the phosphorylation of STAT1. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). Mutations in the gene IFNGR1 which encodes the IFN-gamma R1 cause a primary immunodeficiency and leads to mycobacterial infection, such as Mendelian susceptibility to mycobacterial disease (MSMD)^[2]
Human IFN-gamma R1 consists of extracellular domain (E18-G245), helical domain (S246-I266), and cytoplasmic domain (C267-S489). The sequence of amino acids in IFNAR1 differs in different species. Human IFN-gamma R1 shares 50% aa sequence identity with mouse. IFN-gamma R1 plays a critical role in antimicrobial, antiviral, and antitumor responses^[2].

Immobilized Human IFN-γ at 5 μg/mL (100 μL/well) can bind Biotinylated IFN-γR1 protein. The ED₅₀ for this effect is ≤201 ng/mL.

• 
  Immobilized Human IFN-γ at 5 μg/mL (100 μL/well) can bind Biotinylated IFN-γR1 protein. The ED₅₀ for this effect is 200.9 ng/mL.

Human

HEK293

C-6*His

P15260-1/NP_000407.1 (E18-G245)

3459  [NCBI]

Extracellular Domain

EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

40-50 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.22 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Castro F, et al. Interferon-Gamma at the Crossroads of Tumor Immune Surveillance or Evasion. Front Immunol. 2018 May 4;9:847.  [Content Brief]

  [2]. van de Vosse E, et al. IFN-γR1 defects: Mutation update and description of the IFNGR1 variation database. Hum Mutat. 2017 Oct;38(10):1286-1296.  [Content Brief]