1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-lambda
  5. IFN-lambda 3/IL-28B
  6. IFN-lambda 3/IL-28B Protein, Human (HEK293, His)

IFN-lambda 3/IL-28B Protein, Human (HEK293, His)

Cat. No.: HY-P72552
COA Handling Instructions

IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. IFN-lambda 3 has high similar 96% sequence identity with IFN-lambda 2 at the amino acid level. IFN-lambda 2 has antiviral antitumour and immunomodulatory activities. IFN-lambda 2 signals through a heterodimeric receptor complex comprising IFNLR1 and IL-10RB. When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to tyrosine phosphorylation of the IFN-λR1 and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 form a trimeric transcription factor complex (ISGF3). The formed ISGF3 then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs). IFN-lambda 3/IL-28B Protein, Human (HEK293, His) is a recombinant human IFN-lambda 3 (V22-V196) with C-terminal 6*His tag, which is expressed in HEK293.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $240 In-stock
50 μg $705 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. IFN-lambda 3 has high similar 96% sequence identity with IFN-lambda 2 at the amino acid level. IFN-lambda 2 has antiviral antitumour and immunomodulatory activities[1]. IFN-lambda 2 signals through a heterodimeric receptor complex comprising IFNLR1 and IL-10RB. When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to tyrosine phosphorylation of the IFN-λR1 and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 form a trimeric transcription factor complex (ISGF3). The formed ISGF3 then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs)[2]. IFN-lambda 3/IL-28B Protein, Human (HEK293, His) is a recombinant human IFN-lambda 3 (V22-V196) with C-terminal 6*His tag, which is expressed in HEK293.

Background

IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. Human IFN-lambda 2 shares 61.98% common aa identity with mouse. IFN-lambda 2 is produced particularly by dendritic cells (DCs), when following viral or bacterial infection[3].
IFN-lambda 3 mediates effects by a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 (p48) form a trimeric transcription factor complex (ISGF3). The formed ISGF3 complexes then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs) such as IRF7, MX1, and OAS1[2].
IFN-lambda 3 has antiviral antitumour and immunomodulatory activities[1]. Genetic variants in the IFN-lambda 3 g is associated with pulmonary fibrosis in patients with systemic sclerosis[4].

In Vitro

IFN-lambda 3 (human, 100 ng/mL, 2 h) inhibits Influenza H1N1-induced Th2 response and B cell activation in PBMCs from transplant recipients[5].
IFN-lambda 3 (human, 0.15 μg/mL) inhibits HCV propagation in Huh7.5.1 cells[6].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8IZI9 (V22-V196)

Gene ID
Molecular Construction
N-term
IFN-λ3 (V22-V196)
Accession # Q8IZI9
6*His
C-term
Synonyms
Interferon lambda-3; IFN-lambda-3; IL-28B; IL-28C; ZCYTO22
AA Sequence

VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Molecular Weight

Approximately 22 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl,1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-lambda 3/IL-28B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-lambda 3/IL-28B Protein, Human (HEK293, His)
Cat. No.:
HY-P72552
Quantity:
MCE Japan Authorized Agent: