IFN-lambda 3/IL-28B Protein, Human (HEK293, His)
Based on 1 Customer Validation
IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. IFN-lambda 3 has high similar 96% sequence identity with IFN-lambda 2 at the amino acid level. IFN-lambda 2 has antiviral antitumour and immunomodulatory activities. IFN-lambda 2 signals through a heterodimeric receptor complex comprising IFNLR1 and IL-10RB. When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to tyrosine phosphorylation of the IFN-λR1 and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 form a trimeric transcription factor complex (ISGF3). The formed ISGF3 then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs). IFN-lambda 3/IL-28B Protein, Human (HEK293, His) is a recombinant human IFN-lambda 3 (V22-V196) with C-terminal 6*His tag, which is expressed in HEK293.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. IFN-lambda 3 has high similar 96% sequence identity with IFN-lambda 2 at the amino acid level. IFN-lambda 2 has antiviral antitumour and immunomodulatory activities[1]. IFN-lambda 2 signals through a heterodimeric receptor complex comprising IFNLR1 and IL-10RB. When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to tyrosine phosphorylation of the IFN-λR1 and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 form a trimeric transcription factor complex (ISGF3). The formed ISGF3 then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs)[2]. IFN-lambda 3/IL-28B Protein, Human (HEK293, His) is a recombinant human IFN-lambda 3 (V22-V196) with C-terminal 6*His tag, which is expressed in HEK293.
Background
IFN-lambda 3 (IL-28B) is a member of the Type-III interferon family. Human IFN-lambda 2 shares 61.98% common aa identity with mouse. IFN-lambda 2 is produced particularly by dendritic cells (DCs), when following viral or bacterial infection[3].
IFN-lambda 3 mediates effects by a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2. Activated STAT1 and STAT2 together with IRF-9 (p48) form a trimeric transcription factor complex (ISGF3). The formed ISGF3 complexes then translocate to the nucleus and promotes the production of IFN-stimulated genes (ISGs) such as IRF7, MX1, and OAS1[2].
IFN-lambda 3 has antiviral antitumour and immunomodulatory activities[1]. Genetic variants in the IFN-lambda 3 g is associated with pulmonary fibrosis in patients with systemic sclerosis[4].
In Vitro
IFN-lambda 3 (human, 100 ng/mL, 2 h) inhibits Influenza H1N1-induced Th2 response and B cell activation in PBMCs from transplant recipients[5].
IFN-lambda 3 (human, 0.15 μg/mL) inhibits HCV propagation in Huh7.5.1 cells[6].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8IZI9 (V22-V196)
-
Molecular Construction
-
N-term
-
IFN-λ3 (V22-V196)
Accession # Q8IZI9 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNL3; Interleukin-28C; Prev. IL28B; IL-28C; IL-28B; Interferon, Lambda 4; IL28C; Interleukin 28B; Interleukin 28B (Interferon, Lambda 3); Interferon 1IA1; Interferon Lambda-3; IFN-Lambda-4; Cytokine Zcyto22; ZCYTO22; Interleukin-28B; Interferon Lambda 3;
-
AA Sequence
VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
-
Predicted Molecular Mass
20.7 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57(2):171-9. [Content Brief]
[2]. Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30(8):555-64. [Content Brief]
[3]. Witte K, et al. IL-28A, IL-28B, and IL-29: promising cytokines with type I interferon-like properties. Cytokine Growth Factor Rev. 2010 Aug;21(4):237-51. [Content Brief]
[4]. Metwally M, et al. IFNL3 genotype is associated with pulmonary fibrosis in patients with systemic sclerosis. Sci Rep. 2019 Oct 16;9(1):14834. [Content Brief]
[5]. Egli A, et al. IL-28B is a key regulator of B- and T-cell vaccine responses against influenza. PLoS Pathog. 2014 Dec 11;10(12):e1004556. [Content Brief]
[6]. Cheng M, et al. Recombinant human interleukin 28B: anti-HCV potency, receptor usage and restricted cell-type responsiveness. J Antimicrob Chemother. 2012 May;67(5):1080-7. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)