IL-17A (136a.a)-17F Heterodimer Protein, Human (HEK293, His)

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13). IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F^[1][2][3][4]. IL-17A (136a.a)-17F Heterodimer Protein, Human (HEK293, His) is a recombinant human IL-17A-17F heterodimer protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 269 amino acids (IL-17A (I20-A155) & IL-17F (R31-Q163)).

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F belongs to the IL-17 cytokine family. IL-17A-17F heterodimer, IL-17A and IL-17F homodimers can be produced by differentiated Th17 cells^[1][2]. IL-17F shares the most similarities with IL-17A (50% homology)^[2]. Both IL-17A and IL-17F can induces antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13)^[2][3]. IL-17A, IL-17F and IL-17A-17F use the same receptor complex: IL-17RA and IL-17RC heterodimer. And they trigger qualitatively similar signaling pathways. IL-17A-17F shows intermediate biological activity between IL-17A (most potent) and IL-17F (least potent)^[2][4].

IL-17F/IL-17A (5 ng/mL; 16-24 h) induces GRO-, IL-6, and IL-8 secretion in human primary foreskin fibroblast (BJ) cells^[5].
IL-17F/IL-17A binds to IL-17RA.Fc with an EC₅₀ of 329 ng/mL, IL-17A and IL-17F bind to IL-17RA.Fc with EC₅₀s of 19 ng/mL and > 2000 ng/mL, respectively^[5].

Human

HEK293

C-6*His

Q16552 (G24-A155)&AAH70124.1 (R31-Q163)

3605  [NCBI]&112744  [NCBI]

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA&RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ

15-18 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chen K, et al. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14.  [Content Brief]

  [2]. Chang SH, et al. IL-17F: regulation, signaling and function in inflammation. Cytokine. 2009 Apr;46(1):7-11.  [Content Brief]

  [3]. Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.  [Content Brief]

  [4]. McGeachy MJ, et al. The IL-17 Family of Cytokines in Health and Disease. Immunity. 2019 Apr 16;50(4):892-906.  [Content Brief]

  [5]. Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181(4):2799-805.  [Content Brief]